KEGG   Dendroctonus ponderosae (mountain pine beetle): 109537752Help
Entry
109537752         CDS       T04899                                 

Definition
(RefSeq) hexokinase type 2-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00010  Glycolysis / Gluconeogenesis
dpa00051  Fructose and mannose metabolism
dpa00052  Galactose metabolism
dpa00500  Starch and sucrose metabolism
dpa00520  Amino sugar and nucleotide sugar metabolism
dpa01100  Metabolic pathways
dpa01200  Carbon metabolism
Module
dpa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dpa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109537752
   00051 Fructose and mannose metabolism
    109537752
   00052 Galactose metabolism
    109537752
   00500 Starch and sucrose metabolism
    109537752
   00520 Amino sugar and nucleotide sugar metabolism
    109537752
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109537752
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpa04131]
    109537752
Enzymes [BR:dpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109537752
Membrane trafficking [BR:dpa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109537752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Penicillinase_R
Motif
Other DBs
NCBI-GeneID: 109537752
NCBI-ProteinID: XP_019760184
LinkDB All DBs
Position
Unknown
AA seq 485 aa AA seqDB search
MRIKRVITILNDLGRVELDHGPQQGEEYEHAVRSNVSNEIREKCRELIYDNDTLRKIGAI
FLDNIKRGLGKATHADSIVKCFPTYVQDLPDGTETGKFLALDLGGTNFRVLLIELSGEHF
EMKSKIFAIPEHIMLGSGEQLFDHIAECLAIFVKEEQVQHETLPLGFTFSFPLSQRGLTV
GILERWTKGFNCSNVVGNDVVQMLNDAIDRRGDVSIDVMAVLNDSTGTLMSCAWLNKNCR
VGIIIGTGNNGCYVERQENAELFDDVDNGSGKVMINLEMGAFGDDGCLDFVRSEYDKDVD
RNSINPGKQIQEKMISGMYMGELVRLVLEKFTKEGLLFGGKGSDMLFERKRFYTKYVSEI
ESDEPGLFTNQKQILEELGLKHATEQDYVNVRYICECISRRAAHLASATITTLLHKMDEK
KVTVGVDGSVYRYHPHFRNLMMEKIRELCDPSIEFDLMLSEDGSGRGAALVAAVAARHKK
KALTT
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcaaaagagtcatcaccattctcaacgatttgggcagggtggaacttgatcat
ggccctcagcaaggagaagaatacgagcatgccgtaagaagtaacgtatcaaacgagatc
agagaaaaatgccgcgagttaatctatgacaacgacactctaagaaaaattggggccatt
ttcctggataacatcaagcgaggcttgggaaaggccacacatgccgattccatcgtcaaa
tgcttcccaacttacgtccaggacttacccgatggaactgaaaccggcaagtttttggct
ttggatctgggcggcactaatttccgagtgcttttgatcgagctgagcggtgaacacttc
gaaatgaagtcgaaaatttttgccattcccgaacatatcatgcttggatcgggcgaacaa
ttgttcgatcacattgctgagtgcttagcaattttcgtcaaggaggaacaggttcaacat
gaaactttgccgcttggattcaccttcagctttccgctgtcccaacgaggtttaacagtg
ggaattctggaaagatggaccaaaggcttcaactgttccaatgttgttgggaacgatgtg
gtgcaaatgctgaacgatgctatcgatagaagaggagacgtatcgattgacgtcatggca
gtattaaacgactctaccggcacactaatgtcgtgcgcttggttgaacaaaaattgcaga
gttggcattattattggtactggaaacaatgggtgttacgtggaacggcaggaaaacgcg
gaactgttcgacgacgtcgataacggttctggaaaagtgatgatcaatctggaaatgggc
gcttttggagacgatggttgcctggacttcgttcgctccgagtacgataaggacgtcgac
agaaattccataaatcccggcaagcagatacaagagaaaatgatctccgggatgtacatg
ggcgagctagtgagattagttttagagaaattcaccaaagaaggcctgctgtttggcggc
aaaggatccgacatgctgttcgagaggaagcggttttacaccaagtacgtttcggaaatt
gagagcgacgaacctggactgtttaccaaccaaaagcagatcttggaagaactagggctt
aagcatgcgactgaacaagactacgtgaacgtgcggtacatatgcgagtgcattagcagg
agggcggcccatttggcttccgccaccattaccactcttctgcacaagatggatgagaaa
aaagtcacagtgggagtagacggctctgtttaccgctaccatccccatttccgcaatttg
atgatggagaaaatcagggaattgtgcgatccaagtattgagtttgatttgatgttgtct
gaagatggatccggaagaggagcagcgcttgtagcggccgtagcggctcgccacaagaaa
aaggccctcaccacatga

DBGET integrated database retrieval system