KEGG   Dendroctonus ponderosae (mountain pine beetle): 109540967Help
Entry
109540967         CDS       T04899                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific-like isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109540967
Enzymes [BR:dpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109540967
Chromosome and associated proteins [BR:dpa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109540967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 Methyltransf_4 Lge1
Motif
Other DBs
NCBI-GeneID: 109540967
NCBI-ProteinID: XP_019765114
LinkDB All DBs
Position
Unknown
AA seq 1360 aa AA seqDB search
MCLVTFTGLVSPQNSAGMELKLHSPAGAEPVLYTWPLTSGRGNDKHDGALEIVETIRWVC
EDLPELKLPLENNILCDYDTRSYDSMKSLCDRFNRAIDSVVALEKGTSLPAQRLNKYPSR
GLLRHILQQTYNAAVTDPEKLNQYEPFSPEVYGETSYDLVCQMIDQIEITADDVFIDLGS
GVGQVVLQMAAATPCKICLGVERAEVPSRYAEAMNKNFRTWMQWYGKKYGEYKLIRGDFL
TEEHREKINQATIVFVNNFAFGPSVDHQLKERFADLKDGARIVSSKSFCPLNFRITDRNL
SDIGTIMHVSEMSPLRGSVSWTGKPVSYYLHIIDRTKLERYFQRLKKPHLKNGEDESSNS
NSRYSRDKGKRDFAKQLVDSSTDSDSNDSNYGPTTRRAWSDYCSNKGKSSQSEDDGIPNG
KKRQNKKLRRKPSRIKQGGNQQGQKAVAKGRRGRVRKAKPKKAIKITGLDLLHTETLLST
SPQAIGKKLPPAPGCIDQQLTTLSSDLIVHNELDIPAEPAETPYGLQVLLDMCRTNFMQM
INEMRSPRYKVSIENHIEEEKDRNKKLKNRAAQLEKQIKVLIDDSVALLKARMCELGINA
TSPVDLLAKAKEIVCRHKELQAKASKLQGQVAKLETEKDHLAMQRSTEVCESYLERDSGK
ELSPSLAQEYILREISSTLTQRKKLQNEVQRLEGELVSLQKQGEERKQAQVLLSTRQQQI
PAKVSRKSREYRTRSQDWPEVPDIAKIEEQNPEILAQKILETGRKIEASKQLSSITTNKT
SPYPTHKPTASNQKTIVRNNMPAPLPVSKRQKTVHNFAPTIIATNPNNASNNQLQKVQEA
PRIANFEDRLKSIITSVLNEDQQNRTKQSQMATPHLQYNGNIPTAHAPVTSISQPQPPIS
QNFAPHNYPMAQHMQSAKQIGSDQPDYTQVSPAKLALRRHLSQEKLSAAHPTFNPTEGLV
GKLTSAHATFNTPEGLVATRTIGDLVSGEIERTLEISNQSIINAAVDMSDIQSTPTLTAR
SVVNANIPPRPERVSVKVPTVPHELNAAATPKESLSEPMRQVYSPISRPSSTEGGLEGLA
YMAYMHSHVKVTATHQYIAAQQPSPRQQFSPRALIPQTAPEELHAKMKRQRCCKEEEVDI
AEEDGVIEEKWKDTISSGFDRLVAFASTELDKRRRSTDGADSCNTSPDSGIGHGLGDSHI
VPPSKQPIKLHPKPTLFKMPISKTYLESSPVLDQGPDDGGPPRTPSPTSPNPYNIHFSPE
PVKSPTRLNPALMKYQRYSEDKNKKPDAHFKKKFYYREQWRDDEWAKSNDERLGPSHEPV
KDKFRPKGKMWDWNRESHQIAPQTMASEWSRSHDPYSWKN
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttggtgacatttactggtttagttagcccccaaaactctgctggtatggagctg
aagttgcattccccagcgggtgctgagcctgtactatacacttggccgttaacctcgggt
cgaggaaatgataaacatgatggggcacttgaaattgtggagaccattagatgggtgtgt
gaagatctgccggaacttaagctgccattggaaaacaacattctctgtgattatgacaca
agaagctacgacagtatgaagtctttgtgtgatcggtttaatagagctattgacagtgtg
gtagctctggaaaagggaacatcactgccagcccagagattgaacaaatatccatctaga
ggtcttctgcgtcatatattgcaacaaacttacaatgcggctgttactgacccggaaaaa
ttaaatcagtatgagcctttttcgcccgaagtatatggagaaacttcgtatgatttagtg
tgtcaaatgattgatcaaatagaaataactgcagacgatgtgttcattgacttggggtct
ggagtaggtcaggtggttctgcagatggccgctgcgacaccctgtaaaatttgccttggc
gtggaaagagcagaggttccaagtcgctatgctgaggcaatgaacaagaatttcagaact
tggatgcaatggtatggaaagaaatatggagaatacaaactaatacgaggcgactttcta
acggaagaacaccgcgaaaaaatcaatcaggctactattgtctttgtgaataattttgcc
tttggaccatccgttgatcatcaactaaaggagaggtttgctgacttaaaagatggagct
cgcatagtgtcctccaagagcttttgccctttaaattttcgaataactgatagaaactta
agcgatatcggaaccattatgcacgtctcagaaatgtcacctttgagaggttcagtttcc
tggaccggtaaacctgtctcatattatctccatattatagaccgaaccaagttggagaga
tatttccagcggctgaaaaaaccacacttaaagaatggtgaagatgagagctctaattcc
aacagtcgttattcccgtgataagggaaagcgggactttgctaagcagttagtagattca
tcaacagattccgatagtaatgacagtaattacgggcctacgaccaggagagcttggtcg
gactattgttcaaacaaagggaaaagtagccagtctgaggacgatggaattccgaatgga
aagaagcgccagaacaaaaagttgcgtcgcaaaccatctcgaattaaacaaggaggtaat
cagcaggggcagaaggctgttgctaaagggcgtcgtggtagagtaaggaaagccaaacca
aagaaagccatcaagatcactggattagacctgctacatactgaaactttactaagtact
tcacctcaagccattggcaagaaactcccaccagctcctggatgcatcgatcagcagctt
accactctaagttctgacctgatagttcacaatgagttggatattccggcagagcctgcc
gaaactccgtatggcctgcaagtcttattggatatgtgccgaaccaattttatgcaaatg
attaatgaaatgagaagtccaaggtacaaagtgtctatagaaaaccatatagaggaggaa
aaggacagaaacaaaaaactgaaaaatagggcagctcaacttgaaaagcaaattaaagtt
ttaattgacgatagcgtggcattgctgaaagctcgaatgtgcgagttgggaattaatgca
acttcaccggttgatctactagccaaagcaaaagaaatcgtatgtcgccacaaagaattg
caggcgaaagctagtaagcttcaagggcaagtagcaaaacttgaaaccgagaaagatcac
ctcgcaatgcaacggtctactgaagtgtgtgagtcatacctcgaacgtgactccggtaaa
gaattatctccaagtttggcacaggaatacatattgagagaaatatcttcaacgctaacc
caaaggaaaaagttgcaaaacgaagtacagcggttagaaggcgaattagtttcgttgcag
aaacagggcgaggaaagaaagcaggcgcaagtgttgctttccaccagacagcagcagatt
ccagctaaagtttcacgcaaatcgcgtgaatatagaacacggtcacaagactggccggaa
gttccagatatcgctaaaattgaagagcaaaatcctgaaatactagcgcaaaagattttg
gaaactggtcgcaaaatcgaagctagtaagcagctttcgtcaataacaaccaataaaaca
tctccgtacccaactcacaaacccactgcaagcaaccagaaaacgatagttcgaaataat
atgccagccccgttgcctgttagtaaacgacagaaaacagttcataatttcgcgcccaca
ataatagcaactaacccgaacaatgcttcgaataatcaactgcaaaaagtacaagaagct
ccgcgtattgccaatttcgaagatcgactgaaaagcataatcacatcagttttgaatgag
gatcaacagaacaggactaaacagagccagatggcaactcctcatctgcaatataatgga
aatatcccaactgctcacgctcccgttacttcgatctctcaaccgcaacccccaatcagc
caaaattttgcgccacataactatccaatggcacaacacatgcaatccgccaaacaaatc
gggtcggatcaaccggattacactcaagtatccccggctaaactggcactaagacgacat
ctttcacaagaaaaattatcggctgcccaccctacttttaatccgactgaaggccttgta
gggaagctaacgtctgctcatgcaacttttaatacacctgaaggacttgtggctactaga
acgattggtgacttggtttctggagaaattgaacgcactctagagatatctaatcagtcc
ataataaatgctgcagtggatatgagcgacatacagagtacgcctaccttaacagctaga
tcagtagtgaacgctaatattcctccaagaccagagagagtgagcgtcaaagttccaaca
gttccacatgaattaaacgctgcagcaactcctaaagagtcgctttcagaaccaatgcgc
caagtatatagcccaatctctagaccatcttccaccgaaggtggcctcgaaggtttggca
tacatggcttacatgcactcacatgtaaaggtcactgctacccatcagtatatagctgct
cagcaaccttctcccaggcaacagttttctccacgagcattaattccacagactgcacca
gaagaactacacgctaaaatgaaaaggcaaagatgctgcaaggaagaagaagtggatatt
gctgaagaagatggagtgatagaagagaagtggaaagatacgatcagctctggatttgac
cgtttggtagcgtttgcatctaccgaattagataagcgacgccgttctactgatggagca
gacagttgtaatacttcacctgattcaggcatagggcatggtttaggagacagtcatatt
gtacctccgtccaaacaaccaataaagttgcatccgaaaccaaccctattcaagatgcca
atcagtaaaacatatttagagtcttccccagtcttagaccaaggtccggatgatggtgga
ccgcctaggacgccgtctccgacatctcccaatccgtataatatccatttcagtccggag
cctgttaaaagccctacaagacttaacccggctttgatgaaatatcagagatattccgaa
gataaaaataagaaacctgatgctcatttcaagaagaagttttattacagagagcagtgg
agagatgacgagtgggctaaatccaacgatgagaggcttggcccaagtcacgaaccagta
aaagataaatttaggccaaaaggaaaaatgtgggattggaatcgagagtcccaccaaatt
gctcctcaaactatggcaagtgaatggagccgatcacatgatccgtactcttggaaaaat
tga

DBGET integrated database retrieval system