KEGG   Dendroctonus ponderosae (mountain pine beetle): 109541221Help
Entry
109541221         CDS       T04899                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109541221
Peptidases [BR:dpa01002]
 Metallo Peptidases
  Family M2
   109541221
Exosome [BR:dpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109541221
CD molecules [BR:dpa04090]
 Proteins
  109541221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 TBCC_N
Motif
Other DBs
NCBI-GeneID: 109541221
NCBI-ProteinID: XP_019765578
LinkDB All DBs
Position
Unknown
AA seq 651 aa AA seqDB search
MILRIIPILALLLGLCPLHPWAKDASIEEEEYEARNFLILLNRQTERDANRASLAEWAYA
SNLTEENLNNKLAVSSEVARNVKEAWQRVIQFNWQRFSDYSLRRQFQKYSVLGVAALPEE
KFKQLETIISDMQAIYSKAKICPNGQKPEDGAECTLSLEPELTQILSTSKDPEELKHVWL
GWRNAVGAKCRGLYKQYVDLSNDAAKLNNFTDTSEYWLNDYEDANFKASVQSLWKQLQPL
YLQIHAYVRTKLRQKYGDIVSERGPIPVHLLGNMWGQSWNNIGDLMLPYPDVKKDNLTAE
LLKQNYSVTKIFRTAEAFFKSINLTAMPESFWTNSILEKPSDRDIVCHASAWDFQDGKDF
RIKQCTEVTDEQLITAHHEMGHVEYFLQYKEQPLKFREGANDGFHEAIGDLVALSVQSTK
HLKKIGLLPDTPEDPRQVLNNLFNLGLSKITFLPFGYLMDLWRWDVFSGKTAPEDYNCKW
WELREKYQGVEPPLDRSEEDFDPGAKYHIISDVPYLRYFISFVIQYQFHRALCEKAGQYD
PNNAEKPLHQCDIYQSITAGNVLKQMLAMGSSRPWPEALEVITGQRTMDATGILDFFKPL
HKWLETENQKNNATIGWEPSKRVCTRTRQELVGSSTASGPVPEPSASISTP
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgagaataatccccattttggcgcttttgctggggctctgccccctgcatccc
tgggctaaggacgccagtatagaagaagaagagtacgaggcaagaaacttcctcatcctg
ctaaacagacaaacggaacgggacgccaatagggcttcgctagccgaatgggcctacgcc
tcaaacctaacggaagaaaacctgaataacaagctggcggtgtcttcagaggtggccaga
aatgtaaaggaggcctggcagcgggtgatccagttcaactggcagcggttttcggattac
agtctgcggcgccagttccagaagtattcggtgctgggcgtggccgctttgcccgaagaa
aagttcaaacagctggaaaccatcatcagcgacatgcaagccatatactccaaggcgaaa
atctgccctaacgggcagaagcctgaagatggggcagaatgcactctcagcctggaaccg
gagctgacgcagattctgagcacatcaaaagatccagaggaactgaagcacgtctggctg
ggctggcggaatgcagtgggagcgaagtgtcgcggcttatacaagcaatatgtggatctt
tcgaacgacgcggcaaaacttaacaacttcacagacacctccgagtattggctgaatgac
tatgaagatgcgaacttcaaggcttcagtgcagagcctctggaaacagttgcagccgctc
tatttgcaaattcacgcctacgtccgcacgaaattgaggcaaaagtatggggatattgtg
agtgaacgggggccgattcccgttcatttacttggaaacatgtggggccagagctggaac
aacatcggcgatctgatgctgccctatccggatgtaaagaaggacaatctgacggccgag
cttctgaagcagaattactcagtcacgaagatcttccggacagcggaggctttcttcaag
tcgatcaacctcaccgcgatgcccgagagtttttggacgaactccatcctggaaaagcct
tcggatagggacattgtgtgccatgcgtccgcttgggactttcaagacggcaaagacttc
agaatcaaacaatgcaccgaagtaacggatgagcaactaatcaccgcccaccatgagatg
ggccacgtggagtatttcctgcagtacaaagagcagccgctgaagttcagagagggcgca
aacgacgggttccatgaggccatcggggacttggtggcgctttccgtgcagagcaccaaa
catctgaagaaaatcggactgttgcccgacacacccgaggatccgcggcaggtcctcaac
aatctcttcaatctgggactgagcaagatcaccttcctgcccttcgggtacttgatggat
ctgtggaggtgggacgtattctcgggcaaaaccgcccccgaggactacaactgcaagtgg
tgggagttgcgggagaagtatcagggagtggaaccgccgctggataggagcgaggaggac
tttgatccgggcgccaagtaccacattatcagcgatgttccctacttgaggtattttatc
agctttgtcatccagtatcagttccacagggcgttgtgcgaaaaagccggccaatacgat
ccgaataacgcggaaaaaccgttgcatcagtgcgacatttatcaaagcatcaccgcaggc
aatgtgctaaagcaaatgctggccatgggatcgtccaggccttggccggaggcgcttgaa
gtgatcaccggacagcgcacgatggacgccactggaattctggactttttcaagcctctg
cacaagtggctggagacggagaaccagaaaaacaacgccactatcgggtgggaaccgtcg
aaaagagtttgtactaggacgcggcaggagttagtgggaagcagcaccgcaagtgggcca
gtaccggaaccctccgccagcatttcaactccttaa

DBGET integrated database retrieval system