KEGG   Dendroctonus ponderosae (mountain pine beetle): 109542472Help
Entry
109542472         CDS       T04899                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00480  Glutathione metabolism
dpa00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109542472
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    109542472
Enzymes [BR:dpa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     109542472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 109542472
NCBI-ProteinID: XP_019767273
UniProt: J3JZG1
LinkDB All DBs
Position
Unknown
AA seq 244 aa AA seqDB search
MSSKHLAKGSVEPARKEGLLRLYSMQFCPYAQRSRLVLRAKGIPHDIVNINLIQKPEWYF
KIHPEGKVPALLDGDKVIVESLDIGDYLDEKYPQTPLYPAEPALKAKDKEIIQKIGPATT
VFSKCLFGSEERSAEEWVKALIEALQPLEDELATRGTTVFGGDKPNMIDYALWPWGERAG
AIAIKLGAKLSLGDGQIPLLRKWRKAMREDPVAAELYHGPEVFWKVAQFKLKNVEPDYDS
VLTS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaagcatttggccaaagggtcagtagaacccgctagaaaggaagggctcctg
cgcctctattccatgcagttttgcccatacgctcagagatccaggctggtgctgagagcc
aaggggattccgcatgatatagtcaatatcaatctcatccagaagccggaatggtatttt
aaaatacacccagaaggaaaagtgccggcgctgctcgatggagacaaggtgatagttgaa
agcctggacattggcgactatctggacgaaaaatacccgcagacccccttgtatccagcc
gagccagcattgaaagccaaagacaaagaaattatccagaaaatcggcccagccaccaca
gtattttcaaaatgccttttcggcagcgaggaaaggtcagcagaggaatgggtcaaggct
cttattgaggcgttgcagcctttggaggacgaattggccacccgaggaaccacagtgttt
ggaggcgataaaccaaacatgattgattacgcgctgtggccatggggtgaacgagcgggc
gccatcgccatcaaattaggggcgaaactgtctctaggagatgggcaaatccctttgttg
cgcaaatggagaaaggcgatgcgtgaagacccagtagctgccgagctgtatcatggtcca
gaagtgttttggaaagttgcccaattcaagctgaaaaatgttgagcctgattatgattca
gttttgacttcatag

DBGET integrated database retrieval system