KEGG   Dendroctonus ponderosae (mountain pine beetle): 109546578Help
Entry
109546578         CDS       T04899                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109546578
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpa01002]
    109546578
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpa04147]
    109546578
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109546578
Peptidases and inhibitors [BR:dpa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109546578
Exosome [BR:dpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109546578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109546578
NCBI-ProteinID: XP_019773133
LinkDB All DBs
Position
Unknown
AA seq 297 aa AA seqDB search
MQDENFSGKLKMKFALILIALVAAVSANADTTVYKAVYFPAAPVNVSTNLRVVGGLNAER
NQFPYQVSLQRLRLIAYYHICGGTILSPNWVLSAAHCTPNGYTYRVAAGILLQSDSGVLG
QQTVAVAQVINHALYPGNNIVAPNDVSLVRLASSLVYGISVQALPIPPRRYEARGEAILS
GWGLIRTGGSIPDRLQFANLPIVPERECDEILTGFLGTRNPFSVELNVCSGIQFGGESAC
NGDSGGPLFNDGLVVGIVSWVLVPCGGHNAPSVYAKTSAFTDWIVENTRGEVQPGGI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgaaaacttttcgggtaaattaaaaatgaagtttgcgctaattttgatcgca
ttggtagcagcagtatctgccaatgctgataccacggtctacaaagcagtatatttcccc
gctgcaccagtaaatgtcagtaccaacctgcgagtagtcggaggacttaatgccgaaaga
aaccaattcccataccaagtttctctacaacgtctgcgacttatcgcatattatcacatt
tgtggtggaactatactttctccaaattgggttctaagtgctgctcattgtacaccaaat
ggttacacttaccgcgtggcagccggcattcttttgcaatctgacagcggtgttcttggt
caacaaacagtagcggttgctcaagtcatcaatcatgctctctatccaggaaacaacata
gtagcgccaaatgatgtttccttagttcgcttggcttcgagtcttgtctacggaataagt
gtgcaggcccttcctataccacccagaaggtacgaagctagaggagaagcaattttatct
ggttggggtctgatccgaactggaggatctattcccgaccgtcttcaatttgctaatctt
cctattgttccagaacgagaatgcgatgaaatattaactggcttcttgggaacccgaaac
ccgtttagtgtggagctaaatgtgtgctctggaattcaatttggaggagagtcagcttgc
aatggagacagtggtggtccactttttaacgacggtttggttgtcggaatcgtatcgtgg
gtgttggttccatgtgggggacacaatgctccatcagtttacgctaaaacttccgcattc
actgactggattgtggaaaatacccgtggcgaagtccaaccaggaggaatctaa

DBGET integrated database retrieval system