KEGG   Dendroctonus ponderosae (mountain pine beetle): 109546947Help
Entry
109546947         CDS       T04899                                 

Definition
(RefSeq) WD repeat and HMG-box DNA-binding protein 1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpa03036]
    109546947
Chromosome and associated proteins [BR:dpa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    109546947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 Hira Ge1_WD40 Pur_DNA_glyco
Motif
Other DBs
NCBI-GeneID: 109546947
NCBI-ProteinID: XP_019773682
LinkDB All DBs
Position
Unknown
AA seq 954 aa AA seqDB search
MKIIHEPLRYAHEEGHTDVCYSADGEHFITCGADGDVRIWSVDEMDDPNHTCVGELALSV
CQKDDKIYTSTGNNEIQILTHPAGERDGVFTRATDPFNQIVICRNKNFAAVAGEGMSVTV
MDLDTSVAKISLSDLGAPCLSVAICPNAAKLAASTGDGKLRIWDVESYSLLKEISCFPKV
NSFANAKNLCRLDFEPKHGELLAYPLKNVVKLLNTTTWAEEELKCPEVAADFSVLQYSSC
GKYLAAASLKGDFVIWETLKKTVFQTSKHDASNAICGLMWNPKGNGEIVYTDVEGQVSIM
SNCSRLQPVDNEEISTEVEKVDENGFTENDVDFGDFLEEEKNEDTDRASPEVLDFGTLDS
PDPDARSVDEIASSPGSTRRPRTPDVPMQSPFMPTSTPEHLDPRYLCWNDVGVVKGYGLN
SGDEANQKTIEVEFHDSTFHNSMMLQNFQDYTMGSIGKGALAVANSSQIMVIPLAVSNKE
WYLKVEEYEEIVLVAASESMVCFAMSNYLVRVATIFGTQRGIVSVPGPPVCMAAFKNALL
VAYHAGPVRNSDQNIIIKLFKFEGLNVDCFELGSALGPESTLYWLGFSDIGTPGMMDSLG
MLSLFPPKCNTWIPFCDTTKHRRSPGDGFFVTTIFESNQTIGGIRCKGTVYPGFVPRPTV
CELAIEPPFAETATDKTQMEMNMFTWSNLNIQDTERKYKETALKIFALACKNDLDQRAFE
FMQLVGNQQILNLGLKYTTKLNKRRLSEKLMDLAAVLQEENGDADDTPKSFHSVVSTTEM
QMPAQAVIKPRVGKLSISKLTPKTKKTKQEGSQQDFETNTPISNENNLSAVNSQDSLFSE
DQSVSDETLKAYEVVEVPRNPFLKKQPTEKARDDLNETKSLTPIFNPFLKKAKKTGSASP
LSLTDKNAGISYETPDAKQKSTEVGEKRRLADAESEKPVGKQRKLNQFMFSKRQ
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatacacgagccactgcggtatgcccatgaggaagggcatacagatgtgtgt
tattctgcagatggagagcactttatcacctgtggagctgatggagatgttcggatatgg
tcagtggatgaaatggacgatcctaatcacacatgtgtgggcgaattggctctaagcgtg
tgccagaaggatgataaaatttacacttccactggaaacaatgaaattcaaattctcaca
catccagcaggggaacgagatggagtgttcaccagggctacagatccttttaatcagatt
gtgatttgcaggaacaagaactttgcagccgtagcaggcgaaggcatgtctgtaactgta
atggacctggatacttcagtagcaaagatttctctaagtgatttaggagcgccttgttta
agtgtagcgatttgtcccaatgcggccaaactggctgcctccactggagacggcaagttg
cgcatttgggacgtggaatcctactctctcctcaaggaaatatcctgttttcctaaagtc
aatagctttgcaaacgcaaaaaatttgtgtcgtctggattttgaaccaaagcacggcgaa
ctgttggcttatcccctgaagaacgtggtgaaacttctcaacacaactacatgggcggaa
gaggaactaaaatgtccagaggtggctgcagatttctcagtgttacagtattcaagctgc
ggcaagtatttagcagcagcttcacttaaaggcgactttgtgatatgggagacattaaag
aaaacagtctttcagacttcaaagcacgatgcatcgaatgctatttgtggacttatgtgg
aatcctaaaggaaatggggaaattgtctatacagacgtggaaggccaggtcagtatcatg
tccaactgctcaagactgcagcctgtcgataacgaggaaatatcgaccgaagtggaaaag
gttgatgaaaacggcttcacagagaacgatgtcgattttggcgattttctggaagaggaa
aagaacgaagacactgatcgagcctcgccggaggttctagattttggcacccttgacagt
cctgatcccgatgcacgcagcgtggatgaaatagcttcatctccaggcagcacgagaaga
ccgcgaactccagacgttccaatgcagtcgccctttatgcctacatccactccagagcat
ctggatcctcgatacctctgctggaatgatgtgggagtcgtaaaaggctacgggctaaac
tcgggagacgaagcaaaccagaaaaccattgaagtcgagttccatgactccactttccat
aacagcatgatgctgcagaattttcaggactacaccatgggttcaattggaaaaggagct
ctagcggtagccaattctagccaaatcatggtgattccgctggcagtcagcaacaaagag
tggtacttaaaagtggaggagtatgaggaaatagtgctggtggcagcctccgaaagtatg
gtctgttttgccatgtccaactatctagtgagagttgccacgatttttgggacccagaga
gggatagtgtccgtgcctggacctcctgtgtgtatggcggcgttcaaaaatgccttacta
gtcgcttatcatgccggtccagtgagaaacagcgaccaaaacatcattataaaattattc
aagtttgaaggcctgaacgtggactgtttcgagctggggtcggctttaggcccggaatct
acgttatattggctaggattttctgatattggcacaccaggaatgatggattctttgggg
atgctcagtcttttccctccaaagtgcaacacttggattcctttctgtgataccactaag
catcgtagaagtccaggcgatggatttttcgtaacaacaatattcgaatcgaatcaaaca
attggcggaatccgttgtaaagggacggtttatccgggcttcgtaccgcggcccacggtg
tgtgagctcgccattgagcccccatttgctgaaaccgcgaccgataaaacccagatggaa
atgaacatgttcacgtggtcgaacttgaacatccaggatacggagcggaaatataaagag
actgccttgaaaatttttgcgctggcctgcaaaaatgacctggatcaaagagcgtttgag
ttcatgcaactggtgggcaatcaacagattttgaacttggggctgaaatataccacgaaa
ttgaacaagaggagactgagtgagaagctgatggatttggctgcagtgctgcaggaagag
aatggagatgccgatgacactcccaagtcgtttcatagcgtggtttcaacgactgaaatg
caaatgcctgcgcaagcagtaattaagcccagagtggggaagctgagcatctcgaaacta
acgcccaaaaccaagaagaccaaacaagagggaagccagcaagattttgaaacgaatacg
cccattagcaatgaaaacaatctttcagcggttaacagtcaggattcgcttttcagcgaa
gatcagtcggtatcggatgaaactctcaaggcctatgaagttgtagaagtaccgcgaaac
ccgtttttaaaaaagcagccaacagaaaaggcgagagacgacttaaatgagaccaaaagt
ctcaccccaatatttaatccatttttgaagaaggcaaagaaaacgggcagcgctagtccc
ttgagtttaacagacaagaatgcgggaatcagttatgaaacgcccgacgccaaacagaaa
agtactgaggttggagagaagagaagattggcggacgccgaatcggaaaagccagtagga
aaacagcgaaaactcaaccaatttatgttttccaaacgacaatga

DBGET integrated database retrieval system