KEGG   Candidatus Babela massiliensis: BABL1_gene_166Help
Entry
BABL1_gene_166    CDS       T02948                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
dpb  Candidatus Babela massiliensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: CDK30848
UniProt: V6DIT8
LinkDB All DBs
Position
complement(828689..829717)
Genome map
AA seq 342 aa AA seqDB search
MKTKIKKIISKLSLKSQKEIQEVSMPKWVDPMLATLTQDYFSSDHFISEHKWDGERIIAY
KSSNKVSLMTRNKKLANDNYPELVKNIQNQAINNFILDGEMVAQENNKSNFSVLQKIMHS
GSPKLSKNIEIFYYVFDIIYLDKYDLTNLELIDRKFLLENSIEFKDQLKFTEYYIGKQIE
HFKKACQLGWEGLIVKNIHSKYEKIRSKSWLKFKCFEQQELVITGYTDPQKSRVGFGALL
LGYYENNKLIYAGKVGAGFNRETLKELKEKLSKIEQKDNPFNPPDSSIKKSKSIHWVLPK
LVAEIRFSQWTAYNKLRHPRFMGLRYDKDPKEVIKEIPQNYI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaaataaaaaagataataagtaaactttctttaaaatcacaaaaagaaatt
caagaagtcagtatgcctaaatgggttgatcctatgcttgcaactctaactcaagattat
ttttcaagcgatcacttcatttcagagcataaatgggatggtgaaagaattatcgcttat
aaaagcagcaataaagtttctttaatgacaagaaataaaaaattagcaaatgataattat
cctgaactggtaaaaaatattcaaaatcaagctattaataattttattttagatggagaa
atggttgctcaagaaaacaataaaagcaacttttctgttcttcagaaaataatgcatagc
ggctctccaaaattaagtaaaaatatagaaatattttactatgtttttgatattatttac
ttagataaatatgatctgactaacttggaattaatagatcgtaaatttttacttgaaaat
agtattgagtttaaagatcaattaaaattcacagaatattatataggaaaacaaattgag
cattttaaaaaagcttgccaattaggctgggaaggtttaatagtaaaaaatattcattca
aaatatgagaaaattcgttctaaatcctggttaaagttcaaatgttttgaacaacaagaa
ctggtaattacaggttataccgaccctcaaaaaagtagagtaggttttggggcactattg
ttaggatattatgaaaataataaattgatctatgcgggaaaagtaggcgcaggttttaac
agagaaactctaaaagaactaaaagaaaaactttcaaagattgaacagaaagataatcct
tttaatccacccgatagctcaataaaaaaatcaaaatcaattcattgggttttaccaaaa
ttagttgctgaaataagatttagtcagtggactgcttataataaactaagacatcctaga
tttatgggtttaagatatgataaagatccaaaagaagtaattaaagaaattcctcaaaat
tatatttaa

DBGET integrated database retrieval system