KEGG   Dietzia psychralcaliphila: A6048_04360Help
Entry
A6048_04360       CDS       T05437                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
dpc  Dietzia psychralcaliphila
Pathway
dpc00020  Citrate cycle (TCA cycle)
dpc00480  Glutathione metabolism
dpc01100  Metabolic pathways
dpc01110  Biosynthesis of secondary metabolites
dpc01120  Microbial metabolism in diverse environments
dpc01130  Biosynthesis of antibiotics
dpc01200  Carbon metabolism
dpc01210  2-Oxocarboxylic acid metabolism
dpc01230  Biosynthesis of amino acids
Module
dpc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6048_04360
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A6048_04360
Enzymes [BR:dpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A6048_04360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AWH94851
UniProt: A0A2T5AJF0
LinkDB All DBs
Position
985925..987142
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWKFIKDELIHPYLDVDLEYYDLGIENRDASDDQVTVDS
ANAIKKHGVGVKCATITPDEARMEEFGLKRMYRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIVGRHAFGDQYRATDFKAPGAGKVTITFTPADGSEPIEHEIVEMPEDGGVVM
GMYNFTKSIEDFARASFNYGLQHDYPVYLSTKNTILKAYDGAFKDIFQDVFDREFKAEFD
AADLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
KTCEAEAAHGTVTRHFRQHQQGKPTSTNPIASIFAWTRGLEHRGTLDNTPEVIEFAHQLE
DVVITTVEGGQMTKDLALLVGEDQDYLTTEDFLAALDENLKRARA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagatcaaggtcgaggggacggtcgtcgaactcgacggcgacgagatgacccgc
atcatctggaagttcatcaaggacgagttgatccatccctacctggatgtggatctcgag
tactacgacctcggcatcgagaaccgtgacgcctcggacgaccaggtcaccgtggattcc
gccaacgccatcaagaagcacggcgtgggcgtcaagtgcgccaccatcactcccgacgag
gctcgcatggaggagttcggactgaagcggatgtaccgctcgccgaacggcaccatccgc
aacattctcggcgggacgatcttccgcgcaccgatcatcatctccaacgtcccccgcctg
gtgccgggctggaccaagccgatcatcgtgggccgccacgccttcggcgaccagtaccgc
gccaccgacttcaaggctcccggcgccggcaaggtcaccatcacgttcacgccggccgac
ggttccgagccgatcgagcacgagatcgtcgagatgccggaagacggcggcgtggtcatg
ggcatgtacaacttcaccaagtcgatcgaggacttcgcacgcgcctcgttcaactacggg
ctgcagcacgactacccggtgtacctgtccaccaagaacaccattctcaaggcctacgac
ggcgccttcaaggacatcttccaggacgtcttcgaccgcgagttcaaggccgagttcgat
gccgccgacctgacctatgagcaccgcctcatcgacgacatggtcgcctccgcgctcaag
tgggagggcgggtatgtctgggcctgtaagaactacgacggcgacgtgcagtccgacacg
gtggcccagggcttcggttcgctgggcctcatgacctccgtcctgctcaccccggacggt
aagacctgcgaggccgaggccgcccacggaaccgtcacgcgccacttccggcagcatcag
cagggcaaacccacctccaccaatccgatcgcctcgatcttcgcctggacccgtgggctc
gagcaccggggcacgttggacaacaccccagaggtcatcgagttcgcgcaccagctcgag
gacgtcgtcatcacgaccgtcgagggtggccagatgacgaaggatctggccctcctcgtc
ggggaggaccaggactacctcaccacggaggacttcctggcggcactggacgagaacctg
aagcgcgctcgcgcctga

DBGET integrated database retrieval system