KEGG   Dietzia psychralcaliphila: A6048_04870Help
Entry
A6048_04870       CDS       T05437                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
dpc  Dietzia psychralcaliphila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AWH94929
UniProt: A0A2T5AJ33
LinkDB All DBs
Position
1099333..1100805
Genome map
AA seq 490 aa AA seqDB search
MTTSLDRDALLIGTEWRSPATDNVIEVISPHTEEIVARVPEGSVADMDAAVAAAREAFDS
GPWPRMSPQERIEVVARLSALYAARLDDMATLISTEMGSPISFSKLAQAPAPWMQIEAFV
NIAREFPWEETRPGVLGGEVLVRHEPVGVVAAIPPWNVPQFTVLSKLIPALLTGCTIVIK
PAPETPLDTYLLGELLIEAGVPAGVVSIVAGGREVGEHLVRHPAIDKVAFTGSTAAGRKI
GAICGEQLKRCSLELGGKSAAIVLDDADLTSVVEGIKFLGVMNSGQACVAQTRILVSRDR
HDEVARALAEGIGSMVVGDPMDPATEIGPMVAQRQQERVSSYIEIGRQEGAQLLTGGTGR
PDGLDTGWYVQPTVFAGVDNSMRIAQEEIFGPVLSVIAYDDVDDAVRIANDSEYGLAGTV
WTADREAGLGVARRVRTGTYGVNTYTMDFAAPFGGFKASGVGREFGPEGLAQYTEVKTVY
LGEPAPAGDA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctctctcgaccgcgacgccctactcatcggtacggagtggcgctctcccgcg
acggacaacgtcatcgaggtgatcagtccgcacaccgaggagatcgtcgcccgggtcccg
gaggggtcggtcgccgacatggacgccgccgtggccgccgcgcgagaggcgttcgattcc
ggtccgtggccgcggatgagcccgcaggagcggatcgaggtggtcgctaggctctcagcc
ctgtacgccgcgcggttggacgacatggcgaccctgatctccaccgagatgggctcaccg
atctccttcagcaagctggcccaggcgcccgcgccctggatgcagatcgaggcgttcgtc
aacatcgcccgcgagttcccgtgggaggagacccggccgggtgtgctcggcggggaggta
ctcgtccgccacgaaccggtgggtgtggtcgcggcgatcccgccgtggaacgtcccgcag
ttcaccgtgctgtccaaactgatcccggcgctgctgaccggctgcacgatcgtgatcaag
ccggctcccgagaccccgctcgacacctacctgctgggggagctgctgatcgaggcgggc
gtgccggcgggcgtggtgagcatcgtggccggcggccgcgaggtgggcgagcacctggtg
cgccaccccgcgatcgacaaggtcgcctttaccgggtccaccgcggcggggcggaagatc
ggtgcgatctgcggcgagcagctcaagcggtgttcgctggagctcggcggcaagtccgcg
gcgatcgtgttggacgacgcggacctgacgagcgtcgtcgaggggatcaagttccttggc
gtgatgaactcgggtcaggcgtgcgtggcgcagacccgcatcctggtgagccgcgatcgg
cacgacgaggtcgccagggcactggccgaggggatcgggtcgatggtcgtcggcgacccg
atggaccccgccaccgagatcgggccgatggtcgcgcagcgacagcaggagcgcgtgtcc
tcctacatcgagatcgggcgacaggagggcgcccagctcctcaccggcggtaccggccgc
ccggacggtctggacaccggctggtacgttcagccgaccgtgttcgcgggggtcgacaac
tccatgcggatcgcgcaggaggagatcttcggcccggtcctgtccgtgatcgcctacgac
gacgtcgatgacgccgttcggatcgccaacgactccgagtacggactggcggggacggtg
tggaccgcggaccgcgaggccgggctgggcgtggcccgcagggtccgcaccggcacctac
ggggtcaacacgtacacgatggacttcgcggccccgttcggcggcttcaaggcctcgggg
gtcggccgcgagttcggccccgagggcttggcccagtacaccgaggtcaagaccgtctac
ctcggcgagcccgcgcccgccggcgacgcctga

DBGET integrated database retrieval system