KEGG   Dietzia psychralcaliphila: A6048_12455Help
Entry
A6048_12455       CDS       T05437                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
dpc  Dietzia psychralcaliphila
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dpc03012]
    A6048_12455
   03029 Mitochondrial biogenesis [BR:dpc03029]
    A6048_12455
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpc04147]
    A6048_12455
Translation factors [BR:dpc03012]
 Eukaryotic Type
  Elongation factors
   A6048_12455
 Prokaryotic Type
   A6048_12455
Mitochondrial biogenesis [BR:dpc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A6048_12455
Exosome [BR:dpc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A6048_12455
  Exosomal proteins of breast cancer cells
   A6048_12455
  Exosomal proteins of colorectal cancer cells
   A6048_12455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase PP1_inhibitor
Motif
Other DBs
NCBI-ProteinID: AWH96179
UniProt: A0A2T5AVK1
LinkDB All DBs
Position
complement(2731342..2732532)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADTFPDLNDAFAFDEIDKAPEEKA
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEILELVEMEVRELLASQEFDEDAPVVHISALKAL
EGDEKWVQAIRDLMQACDDSVPDPERETEKPFLMPVEDVFTITGRGTVVTGRIERGKVNV
NEDVELIGIKEKATKTTITGIEMFRKLLDYGEAGDNVGLLVRGLKREEVERGQVVIKPGA
YTPHTNFEGQAYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNTE
MSVELIQPVAMDEGLRFAIREGGRTVGAGQVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggcgaagttcgagcggaccaaaccgcacgttaacatcggcaccatcggtcac
gtcgaccatggcaagaccaccaccaccgcggccatcaccaaggtcctggcggacaccttc
cccgatctcaacgacgcgttcgcgttcgacgagatcgacaaggcgccggaggagaaggct
cgtggtatcacgatcaacatctcccacgtcgagtaccagacggagaagcgccactacgcg
cacgtcgacgccccgggtcacgccgactacatcaagaacatgatcaccggtgccgcccag
atggacggcgcgatcctggtcgtggcggccaccgacggcccgatgccgcagacgcgtgag
cacgtgctgctcgcccgtcaggtcggcgtcccctacatcctcgtcgccctcaacaagtgc
gacatggtcgacgacgaggagatcctcgagctcgtcgagatggaggtgcgtgagctcctc
gcctcgcaggagttcgacgaggacgcccccgtcgtccacatctcggccctcaaggcactc
gagggtgacgagaagtgggtccaggccatccgtgacctgatgcaggcctgcgacgactcc
gtgccggaccccgagcgtgagacggagaagccgttcctcatgcccgtcgaggacgtcttc
acgatcaccggtcgtggcaccgtcgtcaccggtcgtatcgagcgtggcaaggtcaacgtg
aacgaggatgtcgagctcatcggcatcaaggagaaggccaccaagaccacgatcacgggc
atcgagatgttccgtaagctcctcgactacggcgaggccggcgacaacgtcggtctgctc
gtccgtggcctcaagcgcgaggaggtcgagcgcggccaggtcgtcatcaagccgggcgcg
tacaccccgcacacgaacttcgagggccaggcgtacatcctgtccaaggacgagggcggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtaccacggacgtg
accggcgtcgtgaccctccccgagggcaccgagatggtcatgccgggcgacaacaccgag
atgagcgtcgagctcatccagccggtcgccatggatgagggcctgcgcttcgcgatccgt
gagggtggccgcaccgtcggcgccggtcaggtcaccaagatcatcaagtga

DBGET integrated database retrieval system