KEGG   Dietzia psychralcaliphila: A6048_14685
Entry
A6048_14685       CDS       T05437                                 

Definition
(GenBank) acetyltransferase
  KO
K06975  uncharacterized protein
Organism
dpc  Dietzia psychralcaliphila
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    A6048_14685
SSDB
Motif
Pfam: Acetyltransf_CG Acetyltransf_1 Acetyltransf_10
Other DBs
NCBI-ProteinID: AWH96529
UniProt: A0A2T5AUC5
LinkDB
Position
complement(3203295..3203591)
AA seq 98 aa
MSGEKSLVLVHNTDRDRFELWDGETFMGLVGYEKDGEVYILLHTVIEEHFGQQGIARLLV
SMVLTRMRLDGRKIRPVCSYVRRFLIRFPEYQLLVAPR
NT seq 297 nt   +upstreamnt  +downstreamnt
atgtccggagagaagtcactggtgttggtccacaacaccgatagagaccggttcgaactg
tgggacggcgagaccttcatgggcctggtggggtacgagaaggacggcgaggtctacatc
ctgctccacaccgtcatcgaggagcatttcggccagcagggcatcgcccgactgctggtg
agtatggtcctcacccggatgcggctcgacggtcgcaagatccgcccggtgtgtagctac
gtccgtcgcttcctcatccgcttccccgagtaccaactgctcgtcgctccccgctga

DBGET integrated database retrieval system