KEGG   Deinococcus peraridilitoris: Deipe_0633Help
Entry
Deipe_0633        CDS       T02381                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00020  Citrate cycle (TCA cycle)
dpd00270  Cysteine and methionine metabolism
dpd00620  Pyruvate metabolism
dpd00630  Glyoxylate and dicarboxylate metabolism
dpd00680  Methane metabolism
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01120  Microbial metabolism in diverse environments
dpd01130  Biosynthesis of antibiotics
dpd01200  Carbon metabolism
Module
dpd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpd_M00012  Glyoxylate cycle
dpd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipe_0633
   00620 Pyruvate metabolism
    Deipe_0633
   00630 Glyoxylate and dicarboxylate metabolism
    Deipe_0633
  09102 Energy metabolism
   00680 Methane metabolism
    Deipe_0633
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Deipe_0633
Enzymes [BR:dpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Deipe_0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AFZ66222
UniProt: K9ZZ77
LinkDB All DBs
Position
complement(640674..641669)
Genome map
AA seq 331 aa AA seqDB search
MTQHMKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEITPALGALRGVVME
LEDCAFPLLAGVVQTDDPNVAFKDAEYALLVGSRPRTKGMERKDLLEANGAIFTVQGKAL
SDVASRNVKVLVVGNPANTNALIAMRSAPNLDPRQFTAMVRLDHNRALSQLASKTGKSVT
TMRHMTIWGNHSVTQYPDLYHAEVDGQNAYELVNDHAWYEQEYIPTVAKRGAAIIEARGA
SSAASAASAAIDHMRDWALGTPEGDWVSMAVPSDGSYGIPEGVIYGFPCTCSGGDYQIVQ
GLDVNEFSRRKMDETYQELAEERDAVQHLFS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcacatgaaacaacctgttcgcgtggccgtcacgggagcggccggccagatc
ggctacagcctgctcttccgcatcgcctcgggcgagatgctcggcaaagaccagccggtc
attctgcagctcctcgaaatcaccccggcgctgggcgcgctcaggggcgtcgtgatggaa
ctcgaagactgcgcctttccgctgctcgcgggcgtggtgcagaccgacgacccgaacgtg
gccttcaaggacgccgagtatgccctgctggtcggcagccgtccacgcaccaagggcatg
gagcgcaaggacctgctcgaagccaacggcgcgatttttacggtgcagggcaaggccctc
agtgatgtcgcgagccgcaacgtgaaggtgctggtcgtcgggaaccccgccaacaccaac
gccctgatcgccatgcgcagcgcacccaacctcgatccccggcagttcaccgccatggtg
cgcctcgaccacaaccgcgcgctctcgcagctcgcaagcaagaccggcaagagcgtcacc
accatgcgccacatgaccatctggggcaaccactcggtcacccagtaccccgacctctac
catgccgaggtggacggccagaatgcctacgagctggtaaacgatcatgcctggtacgag
caggaatacattcccaccgtcgccaagcgcggcgcggcgatcatcgaggcgcgcggtgcg
tcgagcgccgccagtgcggcgagcgccgcgatcgaccacatgcgcgactgggccctgggc
actccggaaggcgactgggtcagcatggctgtgccgagcgacggcagctacggcattcct
gaaggggtcatctacggctttccctgcacctgcagtggcggcgactaccagatcgtccag
ggcctcgacgtgaacgagttcagccgccgcaagatggacgaaacctaccaggagctggcc
gaagagcgcgacgccgttcagcacctgttttcgtaa

DBGET integrated database retrieval system