KEGG   Deinococcus peraridilitoris: Deipe_0805Help
Entry
Deipe_0805        CDS       T02381                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00260  Glycine, serine and threonine metabolism
dpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deipe_0805
Enzymes [BR:dpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Deipe_0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 Methyltransf_25 2-Hacid_dh_C MTS
Motif
Other DBs
NCBI-ProteinID: AFZ66380
UniProt: L0A035
LinkDB All DBs
Position
812711..813754
Genome map
AA seq 347 aa AA seqDB search
MRALSKEARPGALMIDAPEPTPGPGEVLVKVMATSICGTDMHIYNWDGWAQSRFPAPMVF
GHEMTGEVVAVGQGVNPDMVKVGDHVSAETHLACGHCYQCRTGRKHICQNLRILGVDAPG
IFAEYAVIPAENAWVNDPEMPWEIASLQEPFGNAVQTVLAGPGVSSRTVLVTGCGPIGLM
AIQVARASGASLIIATDVNERRLALARSMGADLTINPLAQDVVRTVRDATRGNGVDALLE
FSGNQTAIRQGFGALTYGGHASMLGIPAGAIEFDLANDIVFKAATVIGISGRKMFETWYQ
VRELVTSGKVDLGAVISHHVPLSHFEEVFEAVRAGEAIKPVMLPQER
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccctctccaaagaagcaaggcccggcgcactcatgatcgacgcgccggaaccc
acgcccggtccgggcgaagtgctggtcaaggtcatggcgacctcgatctgcggcaccgac
atgcacatctacaactgggacggttgggcccagagccgctttccggctccgatggtcttc
ggacacgaaatgaccggcgaagtcgtcgcggtaggtcagggcgtcaatcccgacatggtg
aaggtcggcgatcatgtcagcgccgagacgcacctcgcctgcgggcattgttaccagtgc
cgcacgggccgcaagcacatctgccagaatctgcgcattctgggcgtcgacgcacccggc
atcttcgccgagtacgccgtgattccagctgagaacgcctgggtcaacgatcccgagatg
ccctgggaaatcgccagtctgcaagagccttttggcaacgccgtccagacggtgctggcc
gggccgggcgtgagcagcaggaccgtgctggtcacgggctgcggacccatcggcctgatg
gccattcaggtcgcgcgtgcgagcggcgccagcctgatcatcgccactgacgtaaacgaa
aggcgtctggcacttgcccgcagcatgggcgccgacctgacgatcaatccgctggctcag
gacgtggtccgcacggtgcgcgacgccacgcgcggcaacggcgtggacgccttgctggaa
ttcagcggcaaccagacggccatccgccagggttttggggcgctcacctacggcgggcac
gccagcatgctgggcatcccggcgggggccatcgaattcgaccttgccaacgacatcgtc
ttcaaggccgccaccgtgatcggcatctcgggacgcaagatgttcgagacgtggtatcag
gtgcgcgaactcgtcacgagcggcaaggtggatctgggagcggtcatcagccaccacgtg
cccctgtcgcacttcgaggaagttttcgaggcagtgcgggctggcgaggccatcaagccc
gtgatgctgccccaggaacgctga

DBGET integrated database retrieval system