KEGG   Deinococcus peraridilitoris: Deipe_1309Help
Entry
Deipe_1309        CDS       T02381                                 

Definition
(GenBank) sugar phosphate isomerase/epimerase
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00562  Inositol phosphate metabolism
dpd01100  Metabolic pathways
dpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Deipe_1309
Enzymes [BR:dpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     Deipe_1309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N UxuA
Motif
Other DBs
NCBI-ProteinID: AFZ66859
UniProt: L0A081
LinkDB All DBs
Position
1335190..1336086
Genome map
AA seq 298 aa AA seqDB search
MIRVANAPCSWGVIENIDGERGTYATVLNEMQQTGYEGTELGDWGFMPTDPHALSGELAR
RKLALLGSWVSVALHDRNRHAESERDAVRTAQLLAQVGGPHSVVVLGNDPYTDPVRTRHA
GRIRPEHGLSDEGWTVFAQGAERVARAVRRESGLRTVFHHHIGTWVETPAEIERFLSLTD
PEVMGLCFDTGHYTFGGGDAVEGLRRHAERVWHVHFKDHEPRVAERSREQGWDGVTSVAQ
GVFCELGQGSIDFPGVLRELQQLDFRGWIVVEQDVLPGMGSPRESARRNREYLRGLGV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagttgccaatgccccctgctcgtggggcgtgatcgaaaacatcgatggggag
cgtggcacttatgcgaccgtcctcaacgagatgcagcagactggctacgagggcaccgaa
ctgggtgactggggcttcatgcccaccgatccccacgcgctctcgggggaactcgcccgg
cggaagctcgcgctgctgggctcgtgggtgagcgtggcgctgcacgaccgcaaccgtcac
gccgaaagtgaacgtgacgccgtgcgcaccgcgcagctgctcgcgcaggtcggcgggccg
cacagcgtcgtggtgctgggcaacgacccgtacaccgacccggtgcgcacccggcacgcc
gggcgcatccggcccgagcacggcctgagcgacgagggctggaccgtgttcgctcagggc
gccgagcgcgtcgcgcgcgccgtgcggcgtgaaagcggtctgcgcacggtctttcaccac
cacattggcacctgggtggaaaccccggccgaaatcgagcgctttctgagcctcaccgat
cccgaggtgatgggcctgtgctttgacaccgggcactacaccttcgggggtggggacgcc
gtagagggcctccggcgccacgccgagcgcgtctggcacgttcacttcaaggaccacgag
ccgcgcgtggccgagcgctcgcgcgagcagggctgggacggcgtgacctcggtggcgcag
ggcgtgttctgcgagctcggtcagggcagcatcgactttccgggcgtgctgcgcgagttg
cagcagctggacttcaggggctggatcgtggtggagcaggacgtcctgcccggcatgggc
agcccgcgcgaaagcgcgcggcgcaaccgcgagtacctgcgggggctgggcgtgtaa

DBGET integrated database retrieval system