KEGG   Deinococcus peraridilitoris: Deipe_2529Help
Entry
Deipe_2529        CDS       T02381                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00564  Glycerophospholipid metabolism
dpd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Deipe_2529
Enzymes [BR:dpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Deipe_2529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Pyr_redox_2 NAD_binding_8 FAD_binding_3 Thi4 Pyr_redox_3 Lycopene_cycl DUF2554 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AFZ67994
UniProt: L0A3I1
LinkDB All DBs
Position
2533282..2534877
Genome map
AA seq 531 aa AA seqDB search
MSTINPRSTFLEQLRTTPIWDIVIIGGGASGLGAAVEAASRGYKTLLLEAHDFAKGTSSR
STKLVHGGVRYLAQGNIGLVREALRERGLMRKNAPHLVHDMSFVVPAYDWWAGPFYGVGL
KMYDLLAGKLNLGGSKYLGKEETLRHTPTLQGEGLRGGILYHDGQFDDARLAVTLMRTVL
DHGGVTLNYLPVTGLLKEEGKVCGATARDSESGQEFTVRARAVVNATGVFVDQIRRMDEP
GARDMLSPSQGVHVVVDKRFLPGDSAIMIPRTEDGRVLFAVPWHDHVVIGTTDTAVPHAS
LEPRALPEEIEFILRTAGQYMNPAPTRADVKSVYVGLRPLVKAETSDGVGSTAQLSRDHV
LRVAPSGLITLTGGKWTTYRHMGEDAIDRAAEVGALPTRLSLTQGLRLHGWTETPEAAPL
DVYGTDAAHLRQLAGAETALHPELPYLEAEVRWAARCELARTVEDVLSRRTRALLLNARA
SEQAALRVAQLLAEELGHDAHWIATQVAQFRELARGYQLDAVAEPDLSASS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgatcaatccgcgctcgactttcctcgagcaactccgcacaacccctatttgg
gacatcgtcatcatcggcggcggcgcctcgggcctgggcgcggccgtggaggccgcttcg
cgcgggtacaagaccttgctgctcgaagcgcacgatttcgccaagggcacctccagccgc
tcgaccaagctggtgcacggcggcgtgcgctacctcgcgcagggcaacatcggcctggtg
cgcgaagcgctgcgcgaacgtggcctgatgcgcaagaacgctccgcacctcgtgcacgac
atgagcttcgtggtgcccgcctacgactggtgggccgggccgttctacggggtgggtctc
aagatgtacgacctgctggccggcaagctcaacctgggcggcagcaagtacctcggcaag
gaagaaaccctgcgccacacgcccaccctgcaaggtgaggggctgcgcggcggcattctc
taccatgacggccagttcgacgacgcccgcctcgccgtgaccctgatgcgcacggtgctc
gaccacggcggcgtcaccctcaactacctgccggtcaccggcctgctcaaagaggagggc
aaagtctgcggcgccaccgcccgcgacagcgagagcggccaggaattcacggtccgggcc
cgggccgtggtgaacgccacgggggtgttcgtcgaccagatcaggcgcatggacgagccc
ggcgccagggacatgctctcgcccagccagggcgtgcacgtggtggtggacaaacgcttt
ttgccaggagacagcgccatcatgattccgcgcaccgaggacggccgggtgctcttcgcg
gtgccctggcacgaccacgtggtgatcggcacgaccgacacggccgtgccgcatgccagc
ctggaaccgcgcgccctgcccgaggagatcgagttcatcctgcgcaccgccgggcagtat
atgaatcccgcccccaccagggcagacgtgaaaagcgtctacgtggggctgcgcccgctg
gtgaaggccgagaccagcgacggcgtggggtctacggcgcagctgtcgcgcgaccacgtg
ctgcgcgtggcgccctcggggctgatcaccctcacgggcggcaagtggaccacctaccgt
cacatgggcgaggacgccatcgaccgggccgccgaggtgggcgcactgcccacgcggctc
tcgctcacccagggtctaaggctgcacggctggaccgaaacccccgaagcggccccgctg
gacgtgtacggcacggacgccgcgcacctgcggcaactggcgggcgccgagaccgcgctg
caccccgaattgccctacctggaggccgaagtgcgctgggcggcacgctgtgaactggcg
cgcaccgtcgaggacgtgctctcacggcgcacgcgggcacttttgctcaatgcccgcgcg
agcgaacaggcggcactgcgggtggcccagctcctcgccgaggagctgggccacgacgcc
cactggatcgccacgcaagtcgcacagtttcgtgaactcgcgcgcgggtaccagctggac
gctgtggccgagcccgacctgagcgcttcctcctga

DBGET integrated database retrieval system