KEGG   Deinococcus peraridilitoris: Deipe_3321Help
Entry
Deipe_3321        CDS       T02381                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00620  Pyruvate metabolism
dpd00680  Methane metabolism
dpd01100  Metabolic pathways
dpd01120  Microbial metabolism in diverse environments
dpd01200  Carbon metabolism
Module
dpd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Deipe_3321
  09102 Energy metabolism
   00680 Methane metabolism
    Deipe_3321
Enzymes [BR:dpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Deipe_3321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFZ68761
UniProt: L0A4I6
LinkDB All DBs
Position
3335353..3337893
Genome map
AA seq 846 aa AA seqDB search
MTDVRQNARQGELRSDVSTLGRALGTVLREQEGEAFFELVEQVRALVRDARDAGRDAPLR
DVLASASPQDAENLVRAFSWYFQLVNLAEEYERVRALRGREGPRPQSLEDALVKLQARGW
SAEKVEALSRSVELNLTFTAHPTEMRRRTTRTHLEEIARDLPNLNEEALARITAHIEAMW
GTLELRRLKPTVQDEVKAGLSYVRSIAQALPRLSRDWRLAFERVYGRSPQVRDAVSGKGV
ELPLKFSSWMGGDRDGNPFVTPEATRDTLALHAERARDQLLEVLARAFAYVSQQQQGQEP
WRGEIQAIYDGVYDGVARGKDVDVVGRLEALDGALRLAGQRRSADELLGPALTLARTFGR
HLVSLDIREHSEVVGAAVSLLLREAGVENYETLSETEKQQVLRRELASRRPLWPAGEERP
EALERTVGPIREVAHAVRAVGAGAFGRYVISMAESVSDVLEPLLLAREVGFRVLPVPLFE
TLDDLANGPGVIRELLALPEYRRVLQDDVQEIMLGYSDSNKDAGFLAANWALHEAQRNIA
AVCREAGVTWRFFHGRGTSIGRGGGPAARAILGQPGGTIGAGLRLTEQGEALADKYSHPL
LAHRNLEQALHGLLLAAARDDELLPSDWTEALSRGAAASVQAYRALVDHEDFLGFFEAVT
PIHEIARLNIASRPVRRPGAPTLHNLRAIPWVMSWTQNRANLPGWYGLAEGLRAIGEGQA
REMYREWPFFRAVLDNAQMSLAKSDLLIFDEYLRLAPVSALASRIKEAYAETVMRVEDAV
GGPLLLHEPRLRTSIELRNPYVDPIHRLQVELLQRARAQGGEMPEDMERALLLTIQGIAA
GMRNTG
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtccggcaaaacgcgcgtcagggtgaactgcgcagtgatgtcagcacgctg
gggcgcgccctggggaccgtgctgcgcgaacaggaaggtgaagcttttttcgagctggtc
gagcaggtccgtgccctggtccgtgacgcccgcgatgccggacgggacgcgcccctgcgt
gacgtgctggcgagcgcctccccgcaggacgccgagaacctcgtgcgggccttttcgtgg
tacttccagctcgtcaacctggccgaagaatacgagcgggtgcgcgcactgcgcggccgt
gaaggcccacgtccccaaagcctcgaagacgccttggtcaagctgcaggcgcgcggatgg
agcgccgagaaagtcgaggcgctgtcgcgcagtgtcgagctcaacttgaccttcaccgcc
cacccgaccgaaatgcggcggcgcaccacccgcacccacctggaggagatcgcccgcgac
ctgcccaacctgaacgaggaggccctggcccgcataaccgcgcacatcgaggcgatgtgg
ggcacgctggaactgcgccgcctcaagccgaccgtgcaagacgaagtcaaggctggcttg
agctacgttcgctcgatcgcccaggccttgccgcgtctgtcacgcgattggcgtctggcg
ttcgaacgggtctacggccgctcgccgcaagtgcgggacgccgtgtcaggtaagggtgtg
gagctgcccctgaagttctcttcgtggatggggggagaccgcgacgggaatccgttcgtg
acccccgaggcgacgcgggatacgctggccttgcatgccgagcgggcgcgtgaccagttg
cttgaggttctcgcgcgtgcctttgcgtatgtcagccagcagcaacaaggtcaggaaccc
tggcgcggcgaaatccaggccatttatgacggtgtttatgacggtgtcgcgcgcggtaag
gatgtcgacgtggtgggccgcctggaagcgctcgacggcgcgctgcgccttgccgggcag
cgccgcagtgccgatgagttgctgggtcctgccctgaccttggcccgtaccttcggacgt
catctggtcagcctcgacatccgcgagcattccgaggtggtcggcgcggcggtgtcgctg
ctgctgcgtgaagcaggtgtggagaactacgaaacgctttctgaaacggaaaaacagcag
gtgctgcgccgcgaactggcgtcccgccgacccctgtggccggcaggagaggagcgcccc
gaggcgctggaacggacggtggggcccatccgtgaggtcgcccacgcggttcgcgccgtg
ggcgcgggggcctttggccgctatgtcatctcgatggccgagagcgtctcggacgtgctc
gaaccactgctgctggcccgtgaggtgggttttcgggtgttgccggtgccgctgttcgag
acactggacgacctggccaatgggccaggagtcatacgtgagctgctcgcactgcccgag
taccgccgtgtcctgcaggacgacgtgcaggaaatcatgctgggttacagcgacagcaac
aaggacgccggctttctggcagccaactgggccttgcacgaagcacagcgcaacatcgcc
gccgtgtgccgggaagccggggtcacgtggcgcttctttcacggtcgtggcacctcgatc
ggtcggggtggggggccggctgcacgggccattctggggcaaccgggtggtaccatcggt
gcgggtctgcgcctgaccgagcagggagaggcgctggcggacaagtacagccacccgctg
ctggcccaccgtaacctcgaacaggcgctgcacgggttgctgctggcggcagcccgcgac
gatgagctgctgccctccgactggaccgaggcactttcgcgtggcgcagctgcgagcgtg
caggcataccgcgcgctggtcgatcacgaggactttctcggcttcttcgaagcggtgacc
cccattcacgaaatcgcgcgtctcaacatcgcttcgcgccctgtgcggcgtcccggcgca
ccgacgctgcacaacctgcgggctattccgtgggtgatgtcgtggacgcagaaccgtgcg
aacctgccaggctggtacggtctggcagagggactcagggccatcggtgaaggccaggca
cgtgaaatgtaccgcgaatggccctttttccgtgcggtgctggacaacgcccagatgagc
ctcgccaagagtgacttgctgattttcgacgagtacctgcgcctcgcgcctgtctcggcg
ctcgcctcacgtatcaaggaggcctacgccgagacggtcatgcgcgtcgaggacgcagtc
ggcggaccgttgctgctgcacgaaccccgcttgcggacctcgatcgaactgcgcaatccc
tatgtcgacccgattcaccgcctgcaggtcgagttgctgcaacgtgctcgcgcgcagggc
ggggagatgccagaggacatggagcgtgccctgctgctcaccattcagggcattgcggcc
ggcatgcgcaacacgggctga

DBGET integrated database retrieval system