KEGG   Drosophila persimilis: 113565090
Entry
113565090         CDS       T01063                                 

Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
dpe  Drosophila persimilis
Pathway
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113565090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    113565090
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     113565090
Peptidases and inhibitors [BR:dpe01002]
 Cysteine peptidases
  Family C14: caspase family
   113565090
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 113565090
NCBI-ProteinID: XP_026841449
LinkDB
Position
Unknown
AA seq 236 aa
MALPRPPKFGERRMMLRRQLSTETLPEASGEFKPTPTISAPRLIYVFNHETFKNDLHEPR
IGSAKDVQALRKTFEKLQCQIIEIKDPTLAAVKEKISEIERKNFEQQSALIIVLLSHGGE
NEMIVASDNKEYSLHKDVLLPLFKNETLKGKPKILIAQACKGELEADATLMKHSPNEYVK
CFSSTEGFKSYRRPSEGSLYIQTLCKCMDELATEKDFLSIMDEVNLKVDKDSSAEG
NT seq 711 nt   +upstreamnt  +downstreamnt
atggccctccccagaccacccaaatttggcgaacgccgcatgatgttacgtagacagctg
tcaacagaaacgctgccggaagcaagtggagagttcaaacccacgcccacgatatcagct
ccccggctcatttacgtattcaatcatgagacttttaaaaacgatcttcatgaaccccga
attggcagcgcgaaggatgtacaagcgctgcgcaagacattcgagaaactccagtgccag
ataatagaaataaaggatcctacattggctgcggtaaaggagaaaataagtgaaatcgaa
cgaaaaaactttgaacagcagtctgcattgatcattgtcttactgagtcacggaggtgaa
aacgaaatgatcgtggcatcagacaacaaggagtactcactgcacaaggacgttctcttg
ccactatttaaaaacgagactctcaaaggaaagcccaagatcctcattgcgcaggcatgc
aagggcgaattggaagcggatgcaactctaatgaaacacagtcccaacgagtacgtcaag
tgctttagtagcaccgagggctttaagagctatcgcaggccgtccgaagggtccctatac
atccaaactctgtgcaagtgcatggatgagcttgcgactgagaaggactttttatccatc
atggacgaagtgaacttgaaggtcgacaaagactccagtgcagaggggtga

DBGET integrated database retrieval system