KEGG   Drosophila persimilis: 6587216Help
Entry
6587216           CDS       T01063                                 

Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
dpe  Drosophila persimilis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpe01009]
    6587216
Protein phosphatases and associated proteins [BR:dpe01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     6587216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RE_XamI
Motif
Other DBs
NCBI-GeneID: 6587216
NCBI-ProteinID: XP_002013897
FlyBase: FBgn0160734
UniProt: B4G5L7
LinkDB All DBs
Position
Unknown
AA seq 189 aa AA seqDB search
MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFAESTDDRVNFRQFMNVLAHFRPLRDNKQSMLNSREEKLKFAFKMYDLDD
DGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVD
TKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaagtcatcactgttcctccggaacgaggagatagcgcagattcaggaggaa
actggttttactcccaaccaaatcgagagattgtactcgcgcttcacgtcgttggatcgc
aacgactgcgggaccctctcccgcgaggacctgatgcggatcccggagctggccatcaat
ccgctgtgcgagcgcatcgtccactcgttcttcgccgagagcaccgacgatcgggtgaac
tttcggcagttcatgaacgtgctggcccacttccgtccgctgagggataacaagcagagc
atgctcaacagccgggaggagaagctgaagttcgccttcaagatgtatgaccttgatgac
gacggcgtgattagccgggacgagctgctctccattctgcacatgatggtgggcgccaac
atcagccaggaccagctggtcagcattgcggagcgcacaatcctggaggcagacctctgc
tgccagggcaagatatcgttcgaggacttctgcaaggccctagaccgcaccgacgtcgac
acaaagatgtccataaggtttctcaactga

DBGET integrated database retrieval system