KEGG   Drosophila persimilis: 6587727
Entry
6587727           CDS       T01063                                 

Definition
(RefSeq) beclin-1-like protein
  KO
K08334  beclin
Organism
dpe  Drosophila persimilis
Pathway
dpe04136  Autophagy - other
dpe04137  Mitophagy - animal
dpe04140  Autophagy - animal
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6587727
   04136 Autophagy - other
    6587727
   04137 Mitophagy - animal
    6587727
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    6587727
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpe04131]
    6587727
   03029 Mitochondrial biogenesis [BR:dpe03029]
    6587727
Membrane trafficking [BR:dpe04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    6587727
Mitochondrial biogenesis [BR:dpe03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    6587727
SSDB
Motif
Pfam: APG6 APG6_N DUF2147 ATG14 DUF2381
Other DBs
NCBI-GeneID: 6587727
NCBI-ProteinID: XP_002013459
FlyBase: FBgn0161741
UniProt: B4G434
LinkDB
Position
Unknown
AA seq 422 aa
MSEAEKQAVSFACQRCLQPIVLDEQLEKISVHAMAELSLPIYRDNGNTLDTQDASSFDHF
VPPYRLTDSINGTGFMLVSDGRDNKKMSAAFNLKAELFDCLSSNSEIDHPLCEECADSML
EIMDRELRIAEDEWDVYKTYLDELEQQRQAPNVDALDKELDELKKSEQQLLSELGKLKED
EQSLNAAIAQEELEKEKLHEQEESYWREYTKHRRELMLTEDDKRSLESQISYSKQQLDKL
RDTNIFNITFHIWHAGHFGTINNFRLGRLPSVSVDWSEINAAWGQTVLLLSALARKIGLT
FERYRVVPFGNHSYVEVLGENRELPLYGSGGFKFFWDTKFDAAMVAFLDCLTQFQKEVEK
RDTEFLLPYKMEKGKIIDPSTGNSYSIKIQFNSEEQWTKALKFMLTNLKWGLAWVSSQFV
SQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcgaggcggagaaacaggccgtgtccttcgcctgccagcgctgtctccagcccata
gtgctggacgagcaactggagaagattagcgtccatgccatggctgaactctcgctgccc
atctacagggacaatggcaacacgctggacacacaggatgccagcagctttgaccacttt
gtgccaccgtacaggctgacagactccatcaacggaactggcttcatgctcgtttcggat
ggccgtgataacaagaagatgagtgctgcattcaatctgaaggcagagctgttcgactgc
ttgtcctccaactcggagatagaccatcccctgtgcgaggagtgtgccgactccatgcta
gagatcatggatcgagagctgcgcatagccgaagacgagtgggatgtgtacaaaacatat
ctggatgagctagagcagcagcggcaggcccccaatgtggatgccctggacaaggagctg
gacgaactgaagaagagtgaacagcaactgctgtcggagctgggtaagctaaaggaggat
gaacaatcactgaacgctgctatagcgcaagaggagttggagaaggagaagctgcacgag
caggaggagagctactggcgcgagtacaccaaacaccggcgtgagctgatgctcaccgag
gacgacaaacggagcctggagagccagatcagctactcgaagcagcagctggacaagctg
cgcgacacgaacatcttcaacatcacctttcacatctggcatgccgggcactttggcacc
atcaacaacttccgcctgggccgcctgccctccgtttccgtcgactggtcggagataaat
gccgcctgggggcagacggtgctgctcctctccgctctggcccgcaagattggcctcacc
tttgagcggtatcgcgtcgtgccgttcggcaatcactcgtatgtggaggtgctgggcgag
aatcgcgagctgccgctctacggcagcgggggattcaagtttttttgggataccaaattc
gatgcggccatggtggcctttcttgactgccttacccagttccagaaggaggtggagaaa
cgcgacaccgaattcctgctgccctacaaaatggaaaagggcaaaatcattgacccatct
actgggaattcctactcaataaagatacagtttaactcggaggaacagtggacgaaggcc
ttaaagttcatgcttacgaacctgaaatggggtctcgcctgggtctcctcgcaatttgtg
tcgcaatga

DBGET integrated database retrieval system