KEGG   Drosophila persimilis: 6588206
Entry
6588206           CDS       T01063                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 6 isoform X1
  KO
K10586  baculoviral IAP repeat-containing protein 6 (apollon) [EC:2.3.2.23]
Organism
dpe  Drosophila persimilis
Pathway
dpe04120  Ubiquitin mediated proteolysis
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6588206
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6588206
   04215 Apoptosis - multiple species
    6588206
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6588206
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dpe04121]
    6588206
Enzymes [BR:dpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     6588206
Peptidases and inhibitors [BR:dpe01002]
 Peptidase inhibitors
  Family I32: IAP family
   6588206
Ubiquitin system [BR:dpe04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   6588206
SSDB
Motif
Pfam: UQ_con BIRC6 BIR
Other DBs
NCBI-GeneID: 6588206
NCBI-ProteinID: XP_026840500
LinkDB
Position
Unknown
AA seq 5082 aa
MATEQRILKQDGYLDVGDNSGAPARPFEMRNIVYHPQLNVLLLFGCNNVVKVLDVNSGVV
LQTYKLSKNGESVVHGRYMPLQDKILFWDGHNVGLRGDYNGVLLLDTILQAPIGQNDDYI
KLEIILSEAIIFQHCINDLESEGLECPCDISNELTQKINKAQKNAKKGIKAQRWNTICLE
VPYSSMKLVANNVVILLKRLERHIPVLAIASAINERLTDMMMGSRVPDFGWNFSNFKRVL
MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCNVCLVCWEKTD
EPWSEHERHSPICPFVKGEYTQNVPLSITYATSPALSAPGLGFDIISNSDYANVLCTSCS
QTGELSVWSIERHLRLMYSFHVPTLLKDVFEESFEWARVTAICVLPNARARTKVNYVYSA
ANYGGSSSGSGGGGSHAGSNQTSGKFGSVNAQHITSTSTLRAGVVGSKIVLGVSVRQSSG
EVALRMVVLNIVEVYRQSETSASVSNDSGSVSSVGGNLKKTSSHIGTGTTSSSDANCGGV
GNVTQANLESKDDDNKAMTPYEKFADGFDSNGFVSALMTYNKNNGASQPMDDASVLYDFD
LCTLSQILDHNLEDPLGGLMVTSNTVNVGNLPAMGNDMDKLVDDAEMTHQNINNNNNNNN
NNDGNSLGGSTNNNNNNNNNIMLNGSNSSSDKLMASEEIECVVESWTSVNRTNALDGGAG
SGENGDVASASQEIVEIAEIMPSTPKCNQLLVKLLRTKAPETEGSKIIMATVAKEDEEEE
QEADDRMDTDNNDDGSVAAQLLLFDYEDQQISHDYTLAMTFSRAKCPKQLCVLPNFNSAP
EHKDVGAICVVCADGSVEIYSLADFQATTVIEQEGEHFESVVYCRNMDRLCCCSRQGGLL
FYSLNEGDNDSGDELLELEDECSTTLTQAQAGELSVTDGTGRPMAIGAEQHGKLLTVNDS
ISVDVGTETGASTSGAAATHQSVHVHTSPSAQSMGSNNANFLAYKTSDLTLDDLRVLHAL
TQFDDKLTLYSAEVPSCWNDLGQVQKQRKQSQNMRHGGDERDYTRTWRLHNDATTWDEHI
IELNLAQPVSLGHIDLKFTVYQQCSNPAAIQVTLLKQNTNGFGYRMKGPHASYKPNVIDD
NIDLSYIANENPVLSEEYLLAHNAEVLAGPIELSSCIDVCDQGGTATLTSPKLFKTRTRN
FLLHIKTVADPSKEGQTKTRASPLKRHKRRPHHIEMLVKDQKSNKHSNPIPKSPASEYEL
KTAALKLESQSHLQVTLKKIQKAGLKIKHLNKLKVIKTSVDDGASASSQDPSEMLSEQTS
PEPPPDSLVSGELIREGCDWLHEISISVRAVKSQSRISNARMQRIAMLESNGLMEQLLRI
ASDSGSTPLTKNLALDILNWICFIRLNRFRSPKSERLKDQINKQTAANIPDLLAQQFECV
SLAEKHIEQLMRNCIIYSERSTAHKCSKLIIMLTEGVTNLPTELQLFTTLDYTIKEAITN
TFHELPRAQTGSVVRWYTMLTCATSTAESNNSISEQAINLLKEIAGEIDKRWDPCCALLS
TRFGLYGFPFEPEIFDFDFPNLNRHGISSPVALTNVIRSNSAILKVTALDIKRLSSIDGV
DFRTFPYLIRGKSISNQLRGLLEVVQLHFSCVQTSEATRIDNIDSVGGTAASSLVIDDVM
IPKLVVAKEKNDDVQLNDLVNDVESMVEEITEKEGKIDFDSFGMVNGFKDKSVSSLTDLE
HALKEEVKNEKAAILDKLKLSQFLPDLSLLESYILKKQQYAMVASSKLDNWEMAPTSKTQ
LALDTLKPFAGMLPTQEQAAAAAGADPAPAPTAPQQAGVATGGTGGTGDSTVVLDDAAES
EKIMENLSANPCQPIAWHKLITPPPKQMIIIDRMHSGARRFVVLDFGQHILLTDVVIPPC
DELTSLNIDIWCFDEETDCTRLVQMADIQTKTLVLSDIQPPPICRFLKVTIIGRIGMSST
KCKVPLGRFFGHPVVLEHDGYGDQLMRFIKQPKQNLQAQLKSLNALYEDVHCRYSLASTK
LMDVLAPMRHSELSNVAHLQAFINKQRDEELGNLDNSNKVVSLYDECMLLQYQINVIRNV
VLRLERAVNPHLVCTPPPNSGPLTEETLRTASRDKLRVLSLTLVEVLLHFSIEYGIKNIL
PVYQRFNAATAKALFNSLVVYGDAQLQLATCSLLVVMCCFQPWWGDFLAETFCSLFSAQN
CKAFPQDRIFFLLTYLGRRSIGMGACRSIVIDAVLKTLLKLLAPISPHYKFQSEQPSTSA
SASERSANMGSTSDLQLITWLLLFLSVCLDDNERKDKSAARWDFMSCESDFTKTRPNNVP
NSKQLRCFKKRIIQQSKYSVQPYTDWGKKIYMIQNEVITNHPGIFMELSTKAKSGATKTQ
TTATKINMAAANMFMGSGGLPSGSSATKTAATSTSSTSSPKHADSGGGGSSGSETERDSN
FDKGLKTLRMANIKVVIRGLFALLLEMDFDCNMDQFLLTCKVIARLVAACRPSVQLCKIV
TTAQLEQLVRLAVWNDQQQPWAVHAITCLLQDLLDADKQYRDSDVTPTNDAPPRPMEPEV
QEARDLFSDFTSSSSSCSEAQFEMLMPTAREFYQEAVKYNYLPSLIECDDAEFDDMLNDI
DMIERTKPVTKKESNALCKNTFNFFCKSISVAMDSRLDVGLELHVETQLRRLTNRTSLDL
YASLPQVLTNEFVSPPPEAAPWPEYLTQLWSGSEYNGRNTYVMFKNVFDSILADLHYEDT
WVHLEQVLQMWLTLNCELAEKPYTTGISQTDVPRIPFGANAVQGLLLALAWHNDIKLRTW
CLGFQCLLLACNSQPIGDDADCTRINEVIVNDENFEKMLLRFFSGYGMSSSIITNRCAGP
TICKHLHDLLLWLHGKTDSSGIPCKRQLKDILLHVVLQLVQPGGAISNQQGPIDAQNQLV
RDLLMMPTDKGDLNIALKITESVSFLVFNNISNGEKLQCQRGNESNNPGNNFSNLFANVL
GSENPIKQNATICDNSLIINLLRLSSHMVLTEMPRQPSEVTIPEEEEELSTESQTDETKA
EQLNTEGHRSKVPCIADWVLRQFPTMKRLFGTLSQCSTNTFTMMSSGGFLLLKSNTVLDD
PQTIADAVFSLMITLSDKASNPRLVVAPICQYLEETTIQRNATLPRLPLSEPFLWYISKV
LEVTAAVQTFTQLGGIHIICHNLVRLNKTIINMQPGLISLIMQHMTRNTRLKLNTHMAAN
SACKKTTTSTGATSAPATQHPPRSGAQYDGLINFAPFSHIVSENDAAQSAEVLISNPNAT
HRRPRSPAWSYMFYPNETHVDLTITLPTAILLKEVQLVPHTSNLASCPSAVALELSRDYG
VGSIPIGAPMATTGLTCIRLKLSKAEVATSIVIRLYKPKDCGNVGLVQIAVLGQTIFGNR
MQGLRSQGPFMDSLTSCSSPLQTAAMSTIDADAMPEDDAFAKTSIGWVRILSRCFHMAAL
QPDTKLADLIAAYPASYPGFLEACCSLLNIMPMIPSLAQQHLETILLKLGAYNHELSLQL
LRTLLWHTTPQVFKLSSDAVCDLIHEVVTGSSTHLLDKLRVLIDWIMQLHDNYSKQARCN
NPQSGFVKVIASILWRVHVQYQLPELPQLITSALFETCFEWVSVLEQDEPLKSSFDSLLC
ALCFIKPELFNQLLVKLGVKLEPPARGQTDDSKVQSGSAWFRREGSENLMVLLERPTFLK
TLALACQSPAAVYQMLDSGLPKLLAHAVYEYCTHLLAGLEQEAPSLAAAPAPAPAPAQAA
MPTDGQQGSSSLTDFDKAEAPPSASPPNLNTPLLSSSVVPKVLDFFAECCAEGPMRNWLG
TMQGSVFWKPLLQLLCHTHSSQFSKTLPMQQSFIRLERSTINFLTRVSACHPENQEVLTS
LLIGAIICKPLRSVQGTRPTISGFTRQLVLQLLLENEHITVAVRSQHPLQRRDTLSAIMG
GGGSGSGSAASNSISSTSLPVAAVNNHPAKRSSAHYMLFNVTTSTTCQEILMNCVSAYSN
LVYTTSTDPRASEPSGSGNGNGSGSGGTGAPGAAVSSKFVNPKQDKNWDKNCYINLSNVD
LSSLEFLSVGAAVAAKDKRIKDAKNLLAVNKDKETQTTSSTSNVFNVEEFLLQSNWSKKN
QLVIADYPNVVLSGDATISQVLATLEAAGHSLAIPCLTLDLVPLQHGDETIDDKKTKAAC
TEPLPSPLQRFSSNGGLSLLAHYLPTVYPEHSGRKTVMMVTEKEKSPPLADWVKLEPNDE
IYEDLEDTICEPVAKQTPVSSVPQHSLAAFGLFLRLPAYSDVLLRDKLRAQCLLRLVLGV
TGDGEGNDIYSLSLAPSLPTLPFEVFRQLLDTVPLSTDDGMLLRRVVIEVGAMHLVLNCL
GIFSHQSHNNRIGAPINQPSPSGSASGGGNGSTTTTTTNGTAAGAKSSGGDEPTPSGTSD
DKSHMYWAKGTGFGTGSTTQSWNVEQALLRQKSEEEHVTVLLLVLASYINPGDCIPSEMC
GEDILAYHDVRDVPGELPALFQTLLQQSCLIPALSSYLRNDSVLDITRHIPLYRAILKLL
RALSLSKSLVSLLQPAPSACGEGTQSIAELLTNMKTCVDTYAKRLKVNKKSNIKGQTQQL
TFNIDDGDDEGLALLIPDIQETSVLVQKTTDADALINMQSSSEDGSGQLERPLSKSVEQR
YLELMKKRQFDTFDMIVESENNSFRFVVSHHFEKMVRLAGDRYHPSRVKRLAQEAVTLST
SLPLSYSSSVFVRCDTDRLDVMKVLITGPSDTPYANGCFEFDVFFPPDYPNLPMLINLET
TGRHSVRFNPNLYNDGKVCLSVLNTWHGRPEEKWNAQTSSFLQVLVSIQSLILVPEPYFN
EPGFERSRGTPSGTNSSREYNSNIYQACVRWAMLEQIRNPSPCFKDVIHKHFWMKREEVC
TQIEGWIEELSKPQYTERASRTISFNSMVLRRHYRHLREELAKLKPPRGLEDLDAPFNPV
ATLPPMDVSAAPAATTTANVQVGTDGPIVPELNLITDDGDDSDNGPCILDPVSGVLKGVE
EVVEILSDTENESSVWQEKEEEEEDEGDVDGDGDGDGDGEEE
NT seq 15249 nt   +upstreamnt  +downstreamnt
atggccacagagcagcgtattcttaagcaagacgggtacttggatgtgggcgacaatagc
ggagcacccgctcgtccgttcgagatgcgcaacatcgtctaccatccgcaattgaatgtg
ctgctgttgttcggctgcaataatgttgtgaaggttctggatgtcaattctggagttgtt
ttgcagacgtataaattgagtaaaaatggcgaaagcgtcgttcacggtcgttacatgccc
ttgcaagataaaatcttgttctgggatggccacaatgtgggtttgcgcggcgactacaat
ggcgtcctgctgctggataccatattgcaggcgcccattgggcagaacgacgactacatt
aagctggagatcatattgtccgaggcgatcatcttccagcactgcatcaacgatctggag
agcgagggcctcgagtgtccctgcgacattagcaacgagctaacccagaagataaacaag
gcccagaagaatgccaagaagggcatcaaggcccagcgatggaatacaatatgtctggag
gtgccctattccagcatgaagctggtggccaacaacgtggtcatcctgctgaagcgtctg
gagcgtcacattccagtgcttgccatagcatccgccatcaatgagcggctcacagacatg
atgatgggctcgcgggtgcccgatttcggctggaatttcagcaactttaagcgtgtgctc
atgcactcagaggccgtgcgtcgccagacattcgagaagtggccccacatggactacaag
tgggcgctgccggatcaaatggcacaggccggcttctaccatcagccgtcgtcctccggg
gaggatcgtgccatgtgcttcacgtgcaacgtgtgtctggtttgctgggagaagaccgac
gagccctggagcgagcacgagcgccattcgcccatctgtccgtttgtcaagggcgagtac
acgcagaatgtgcccctgtccatcacgtatgccactagtccggccctgtcggcgcctggc
ctcggcttcgacatcatctcaaacagcgactatgcgaatgtgctgtgcaccagctgctct
cagacgggcgagctgagcgtctggagcattgagcgtcatctgcggctgatgtacagcttc
cacgtaccgaccctgctcaaggatgtgttcgaggagagcttcgagtgggcccgcgtgacg
gccatctgtgttctgcccaatgcccgagcccgcaccaaggtcaactacgtctattccgct
gccaattatggtggctctagcagcggcagcggcggcggcggctcgcatgctggctccaat
cagaccagtggcaaatttggcagcgtcaatgcccagcatataacctccacatccacactg
cgcgcgggcgtggtggggtccaagattgtgctgggcgtcagtgtgcgccagagcagcggc
gaggtggccctgcgcatggtggtgctgaatattgtggaggtgtatcgccagagcgagacc
tcggccagcgtgagcaacgacagtggcagcgtctccagcgttgggggaaatctcaagaag
acctcttcacatatcggtaccggaaccacctcctcgagtgatgccaactgtgggggcgtg
ggaaacgtcacccaagcgaatctcgagtccaaggacgatgacaacaaggccatgacaccg
tacgagaaattcgccgatggcttcgatagcaatggctttgtgtccgccttgatgacctac
aacaagaacaatggcgccagccagcccatggacgatgcgtccgtcttgtatgactttgat
ctgtgcactctgtcgcagatactcgatcataatcttgaggatcctcttggcggtctgatg
gtcacctcaaacaccgtcaatgtgggcaatcttcctgccatgggcaatgacatggacaag
cttgtcgacgatgccgagatgacgcatcagaatatcaacaacaacaacaataataacaac
aacaacgatggcaactctttgggcggcagcaccaataacaacaataataacaacaacaac
ataatgctaaatggaagcaacagcagcagcgacaaactgatggccagcgaggagatcgaa
tgtgtcgtcgagagctggaccagcgtgaatcgcacgaatgccttggatgggggggcggga
agcggcgagaacggtgacgttgccagtgcgtcccaagagatcgttgagatagccgagata
atgccctcaacaccgaaatgcaaccagctgctggtcaagctgttgcgcaccaaggcccca
gaaacggagggcagtaagatcattatggccacggtggccaaagaggatgaggaggaggaa
caggaggcagacgaccgcatggatacggacaacaatgacgatggcagtgtggccgctcag
cttttactgttcgactacgaggatcagcagatatcgcatgactacaccctggccatgacc
ttcagccgggccaagtgtcccaaacagctgtgcgtcctgcccaacttcaactccgccccg
gagcacaaggatgtgggcgccatttgtgtggtgtgtgccgatggcagcgtggaaatctac
tcgctggcagacttccaggccaccacagtgatcgagcaggagggcgagcactttgagtct
gttgtctactgccgcaacatggacaggctgtgctgttgctcccgccagggcggtttgctc
ttctactcgctgaacgagggcgacaacgattccggggacgaactgctcgagctggaggac
gagtgcagcacaaccctaacgcaggcgcaggcaggagaactgagtgtcacagatggcact
ggtcgccctatggcgatcggtgccgagcagcacggcaagctgttgaccgtgaacgatagc
ataagtgtggatgtgggcaccgaaacgggggcatccacatcgggagctgccgccacacac
caaagtgtccacgtccacacctcgccctcggcccagtcgatgggctcgaacaatgccaac
tttctggcctacaaaacaagcgacttgacgctcgacgatctgcgcgtgctccatgccctc
acgcagttcgatgacaagctgaccctctactcggcggaagtgcccagctgctggaacgat
ctggggcaggtgcagaagcagcgcaagcagtcccagaacatgcggcatggcggcgatgag
cgtgactacacgcgcacctggcgattgcacaacgatgctaccacttgggacgagcacatc
attgagctcaatttggcacagcccgtgtctctgggtcacattgatctgaagttcacggtg
taccagcaatgctccaatccggcggccatccaggtcaccctgctcaagcagaacacgaat
ggctttggctatcgcatgaagggaccgcatgccagctacaagccgaatgtcattgacgac
aacattgatctctcctacattgccaatgagaatcccgtactcagcgaggaatatctactg
gcccacaatgcagaggttctggccggtcccatcgagctctcgtcctgcattgatgtctgc
gatcaggggggcacggcaacgctgacctcgccgaagctcttcaagacgcgtacccgtaac
tttttgctgcacatcaagacagtggcagatccatccaaggagggacagaccaagacgagg
gcatcccctctgaaacggcacaagcgccgaccccatcatatagagatgttggttaaagac
caaaaatcaaataagcattcgaatccaatccctaagagtccggcgtctgagtacgaattg
aagacggcagctctgaaactcgaaagccaaagccatctgcaagtcacacttaagaaaatc
caaaaagccggcttaaaaatcaaacatttgaacaagttaaaggtgatcaaaacaagcgtt
gacgatggagctagtgcttcttctcaagatccaagcgaaatgctttcagaacaaacttcg
ccagagccgccgcccgattctcttgtttctggggaactgattagggaaggctgcgactgg
ctgcacgagatctccatcagcgtgagggccgtcaagtcgcagagtcgcatcagcaatgcg
agaatgcagcgcatagccatgctggagagcaatggtttaatggagcagctgctacgcatt
gccagcgattcgggatccacgccgctgaccaagaacctggccctcgacatcctcaactgg
atatgtttcattcgcctgaaccgcttccgttcgcccaaatccgagcggctaaaggatcag
atcaacaagcagacggcagccaatatacccgatctgctggcccagcagttcgagtgcgtt
tccctggccgagaagcatattgagcagctgatgaggaactgcatcatctacagcgagcgc
agcacggcccacaagtgctccaagctgataataatgcttacagagggcgtcaccaatcta
cccacggagctgcagctctttaccacgctggactacaccattaaggaggccatcacaaat
accttccacgagctgccccgtgcccagaccggcagtgttgtgcgctggtataccatgctc
acgtgcgccacatccaccgcggagtcgaacaacagcatatcagagcaggccatcaatttg
ctgaaggaaatagccggggagatagacaagcgctgggatccctgctgcgccctgttgagc
acacgctttggcctctacgggttccccttcgagccggagatctttgactttgatttcccc
aatctcaatcggcacggcatcagctcccccgtggccttgacgaatgtgatacgcagcaat
tcggcgatcctcaaagtgacggcactggacattaagcgtttgagttcgattgatggcgtc
gactttcgcacttttccctatctaatacgaggcaagagcatcagcaatcagctgcgcggc
ctgctcgaggtggtccaactgcatttcagttgtgtgcaaacgtcggaggccactcgcatc
gacaacattgacagtgtgggtggcacagcggcctccagtctagtgattgacgatgtgatg
atacccaagctggtggtggccaaggaaaagaacgatgatgtgcagctgaacgatctggtc
aacgatgtggagtccatggtggaggaaatcaccgaaaaggagggaaagatcgactttgat
tcgttcggcatggtcaatggcttcaaggataagtctgtttcctcgctcaccgacctggag
catgccctcaaggaggaggtgaagaacgagaaggctgccattttggacaagctgaagctg
tcacagttcctgcccgacctgtccctgctcgaaagctatattctcaagaagcaacagtat
gccatggtggcttccagcaaactggacaactgggaaatggcaccgacatccaagactcag
ttggcactggataccttgaagccctttgctggaatgttgccgacacaggaacaggcagct
gcagctgctggagcagacccagccccagccccaacagcgccacagcaggcaggagtcgca
acaggcggcacaggggggactggcgacagcactgtcgttctagatgatgccgccgaatcc
gaaaagattatggaaaatctcagcgctaatccgtgtcagccgattgcctggcacaagctg
atcacgccgccgcccaaacaaatgattattatcgatcgcatgcactctggtgcgaggcgg
ttcgtggtgctggactttggccagcacatcctcctcacggacgtggtgatacccccctgc
gacgagctcacgtctctgaacatcgacatctggtgctttgacgaggagacggactgcacg
cgtctcgtccagatggcggatatccagaccaagacgctggtgttgagcgacatacagccg
ccgccgatctgtcgcttcctgaaggtgaccatcatcgggcgcatcgggatgtcgtccacc
aagtgcaaggtgccgctgggtcggttctttggccatcccgttgtgctcgagcacgacggc
tatggggatcagttaatgcgcttcatcaagcagcccaaacagaaccttcaggcacagctc
aagtcgctgaatgccctgtacgaggacgtccactgtcgctacagtttggccagcaccaag
ctgatggatgtcctggcgcccatgcgccacagcgagctttcgaatgtggcccatctgcag
gcgttcatcaacaagcagcgcgacgaggagctcggcaacctggacaacagcaacaaggtg
gtgtccctctacgacgagtgcatgctgctccagtaccaaatcaatgtcatccggaacgtg
gtgctgcgcctggagcgcgcagtcaatccccatttggtgtgcacgccccctccgaactcg
ggtccgctcacagaggaaacgctgcgtactgcctcgcgggacaagctgcgtgtcctcagc
ctcactttggtggaggtgctgctgcacttctccatcgaatacggcatcaagaacatcctg
cccgtctatcagcgcttcaatgcggccacagccaaggctctgttcaactccctggtggtc
tatggcgatgcccagctgcagctggccacctgctccctgctggtggttatgtgctgcttc
cagccgtggtggggagacttcctggccgagaccttttgcagcctcttttccgcacagaac
tgcaaggcctttccacaggatcgcatattctttctgctgacgtatctgggacgccgcagc
attggaatgggcgcctgtcgctcgattgtgattgatgccgtgctcaagaccctcctgaag
ctgctggcccccatttcgccgcactacaaattccagtcggagcagccgagcacatcggcc
agtgcctcagagcgtagcgccaacatgggcagcacatccgatctgcagctgatcacctgg
ctgctcctcttcctctccgtgtgtctggacgacaacgagcgcaaggataaatctgccgca
cgatgggatttcatgagctgcgagagtgacttcaccaagacacggcccaacaatgtgcca
aacagcaaacagttgcgctgcttcaagaagcgcatcatccaacagagcaaatactccgtt
cagccctacacggactggggcaagaagatatacatgattcaaaacgaggtaataacaaat
catcctggcatatttatggagctctccaccaaagccaagagtggcgccaccaaaacccag
acaacagccaccaagatcaatatggctgcggccaatatgtttatgggtagtggcggcctg
ccaagtggcagcagtgccacaaagactgcggccacgtccacgtcctcgacatcgtcgccc
aagcatgcggatagcggcggaggaggatcctctggcagcgagaccgagcgcgacagcaac
tttgacaagggcctcaagacgctgcgaatggccaatataaaggtcgtgatccgtggtctg
tttgccctgctgctggagatggactttgactgcaatatggatcagtttctgctcacctgc
aaggtgattgctcgcctggtggccgcctgccgtccctcagtgcagctgtgcaagattgtg
accaccgcgcagctggagcagctcgtacgcctggccgtgtggaacgatcagcagcagccc
tgggctgtgcacgccatcacatgtctgctgcaggatctgctcgatgcggacaagcagtac
cgggacagcgatgtgacgcccaccaacgatgcaccgccccggcccatggagccagaggtg
caggaagcccgcgatcttttcagtgattttacatcatcgtcttcctcatgctccgaggca
cagttcgagatgctaatgccgacagctcgagagttttatcaggaggccgttaaatacaac
tacttgccctctttgatcgaatgcgatgatgcggagttcgacgacatgctcaacgacatc
gacatgatcgagcgcacaaagccggtgaccaagaaggagagcaatgccctgtgcaagaac
acctttaacttcttctgcaagtccatttcggtggctatggactcgcggctggatgtgggc
ctggagctgcatgtggagacgcagctgagacgcctcacaaatcgcacctccctggacctg
tacgcctccctgccgcaggtgctgacaaacgagtttgtttcgccgccgcccgaggcggcc
ccctggccagagtacttgacccagctgtggtccggatcggagtacaatggtcggaacacg
tacgtgatgttcaagaacgtcttcgactcgatactggccgatctgcactacgaggacacg
tgggtgcatctggagcaggtgctgcagatgtggctgacgctcaactgcgagctggccgag
aagccttacacgacgggcatctcccagacggacgtgcccagaataccgttcggcgcgaat
gccgtccaaggactgctgctggccctggcctggcacaacgacatcaagctgcgcacctgg
tgcctgggcttccagtgcctgctgctcgcgtgcaactcccagccgatcggggacgatgcc
gactgcacgcgaatcaatgaggtgattgtgaatgacgagaactttgagaagatgctgctg
cgtttcttctctggctacggcatgagctcatccataatcacgaatcgctgtgctggaccc
accatttgcaagcatctgcatgatctactgctgtggctgcatggcaagaccgacagcagt
ggaattccctgcaaacgccagctgaaggacatcctgctgcatgtcgtgctgcagctggtg
cagcccggaggggccattagcaaccagcagggccccatagatgcccagaatcagttggtg
cgcgacctgctgatgatgcccaccgacaagggagatttaaacatagccctcaagatcacc
gaaagtgtttctttcctggtcttcaacaacatttccaatggcgagaaactgcagtgccag
cgtggcaatgagagcaacaatcccggcaacaactttagcaatctgttcgcgaatgtcctg
ggctcggagaatcccatcaagcagaatgccacaatatgcgacaattcgctgatcataaat
ctgcttcgattgtcctctcacatggtgctcaccgagatgcccaggcagccaagcgaggta
actattcccgaggaggaggaggagctctccactgaaagccagacggatgagaccaaggca
gagcagctgaacacggaagggcatcgtagcaaagtgccctgcatagccgattgggtgcta
cgccagttcccaacgatgaaacgtctctttggcacgctctcccagtgctccacgaatacg
ttcacgatgatgtcctcgggtggctttctgttgctcaagtcgaacaccgtactcgatgat
ccccagacgattgccgacgccgtcttcagtctgatgataacactcagcgacaaggcctcc
aatccgcgactggtagtggcgcccatctgccagtacctcgaagagaccaccattcagcgg
aatgcaacgctgccgcgtctgccgctgtcggagcccttcctgtggtacatctccaaggtg
ctagaggtgacggcagccgtgcagaccttcacccagctgggcggcatacacattatctgc
cacaatttggtgcggctcaataagacgatcatcaacatgcagccaggattgatctcgctg
attatgcagcacatgacgcggaatactcgcctcaagctgaacacccacatggccgccaac
agtgcctgcaagaagaccaccaccagtacgggcgccacatcggcgcctgccacccagcat
ccaccgcgcagcggggcccagtacgacgggctcattaatttcgcccccttctcgcacatc
gtgtccgagaatgatgcggcccaaagcgccgaggtgctcatatcgaatccgaatgcaacg
cacaggcgtccgcgctccccggcctggagctacatgttctacccgaacgaaacgcatgtc
gatctgaccatcacgctgcccaccgccattctgctgaaggaagtgcaactggtgccgcac
acctccaatctggcctcctgcccctcagccgtggccctcgagctgtcgcgcgactatggc
gtgggctccattccaataggtgcgcccatggccaccacaggactcacctgcatccgcctc
aagctgtccaaggcggaggtggccaccagcattgtgatcaggctgtacaaacccaaggac
tgcgggaacgtgggtctggtgcagattgccgtgctcggccagacaatattcggtaatcgc
atgcaagggctgcgctcgcaggggccgttcatggactcgctgacgtcgtgctcgtcgccg
ctgcaaacggctgccatgtccaccatagacgccgatgccatgccggaggatgatgcattt
gccaagaccagcattggctgggtgcgcatcctgtcgcgttgcttccatatggccgccctg
cagcccgacacgaagctggccgatctgattgccgcctatccggcatcctatccgggcttc
ctggaggcctgctgctcgctgctgaatatcatgcccatgattccgagtctcgcacagcag
catctggagaccatactgctcaagctgggcgcctacaatcacgagcttagtctgcagctc
ctacgaacgctgctgtggcacaccacgccccaggtctttaagctgtccagcgatgctgtg
tgcgatctcatccacgaggtggtcactggctcctcgacgcatctgctggacaagctgcgc
gtgctcatcgactggatcatgcagctgcacgacaactacagcaagcaggcgcgctgcaat
aaccctcagagcggcttcgtcaaggtcattgcctcgatcctgtggcgggtgcacgtccag
tatcagctgccagagctgccgcagctgatcacctcggccctgttcgagacctgcttcgaa
tgggtgtcggtcctggagcaagatgagcccctcaagagcagcttcgattcgctgctctgt
gccctgtgcttcatcaagccggagctgttcaatcagctgctggtcaagctgggcgtaaag
ctggagccgccggctcgtggccagaccgacgacagcaaggtgcagagcggcagcgcctgg
ttccgccgcgagggcagtgagaatctgatggttctcctggaacgtcccacattcctgaag
acgctggccctcgcctgccagtccccggcggctgtctaccaaatgctggactctggcctg
cccaagctgttggcccacgccgtctacgagtactgcactcatctgctggcgggcttggag
caagaagctccttccctagctgcagctccggctccagctccagctccagctcaggcggcg
atgccaactgatggccagcagggctcgtcgtccctcacggactttgacaaggcggaggcg
ccaccaagtgccagcccaccgaatctcaacactccgctgctgagcagctcggttgtgccc
aaagtgctggactttttcgccgagtgctgcgcggagggacccatgcggaactggctgggc
acgatgcagggctctgtgttctggaagccgctgctgcagctcctgtgccacacacactcg
tcgcagttcagcaagacgctgcccatgcagcagtccttcattcgcctagagcgctccact
atcaactttctgacgcgcgtgagtgcctgccatccggagaaccaggaagtgctcacctcc
ctcctcatcggcgccatcatctgcaagccgctgcgatctgtccagggcactcgccccacc
atctccggattcacgcggcaactggtgctgcagctgctgctggagaacgagcacatcacc
gtcgctgtgcgcagtcagcatccactgcagcgccgggacacgctgtccgccattatgggt
ggcggtgggtctgggtctggctctgcggcctcgaacagcatcagcagcaccagcctgccg
gtggcggcagtcaacaatcatccggccaaacgcagcagtgcccactatatgctcttcaat
gtgaccacgagcacgacctgccaggagattctcatgaattgcgttagcgcttatagtaac
ttagtttacactacatcaacagatccgcgcgctagcgagccctcaggcagtggcaatgga
aacgggagtggcagtggtggcacgggtgccccaggagccgccgtaagttccaaattcgtc
aatcccaaacaggacaagaactgggacaagaattgctatatcaatctgagcaatgtggat
ctgagcagcctagagttcctgagcgtgggtgccgccgtggcggccaaggacaaacgcatc
aaagatgccaaaaacctgctggccgttaacaaggacaaggagacgcagacaaccagctcg
acttccaatgtgttcaatgtcgaggagtttctgttgcaatcgaattggtccaagaaaaat
cagctggtcattgcggactatcccaacgtagtgctatctggtgatgccacaatctcccag
gtgctggccacactagaggcggcaggccactcgctggccataccgtgcctgaccctggat
ctggtgcccctccagcatggagacgagaccatcgacgacaagaagacaaaggcagcctgc
acagagccactgccatcgccactgcaacgcttctcgagcaacggtggcctctcgctgctg
gcccactatctgcccactgtgtatccggagcattcgggccgcaagaccgtgatgatggtc
accgaaaaggagaagagtcccccactggcggactgggtgaagctggagccaaacgatgag
atatacgaggatctggaggacaccatttgcgagccagtggccaagcagacgcccgtcagc
tcagtgccgcagcattcgctggccgcctttggactgtttcttcgtttgcccgcctactcc
gatgtcctgctgagggacaagctgcgggcccagtgcctgttgcgtttggttctgggcgtg
acaggcgacggcgagggcaatgacatctatagcctctcgctggcaccctcgctgcccacg
ctgccctttgaggtcttccgccagctgctggacactgtgccgctgtccaccgacgatgga
atgctgctccgccgcgtggtcattgaggtgggggccatgcaccttgtcctcaattgtctg
ggcatcttttcgcatcagtcgcacaacaacaggattggggcaccgatcaaccagccctcg
ccgagtggcagtgccagcggcggtggaaacggaagcacaaccacaacaaccacgaatgga
accgccgctggggccaagagcagtggaggggacgagcccacgcccagtggcacctcggac
gacaagagccacatgtattgggccaagggaacaggcttcggcaccggttccaccacacag
tcgtggaacgtggagcaggccctgctgcgccagaagagcgaggaggagcatgtcaccgtg
ctgctgttggtgctggccagctacatcaatccgggcgactgtatacccagcgagatgtgc
ggcgaggacatactcgcctaccacgatgtgcgcgacgtgcccggggagctgcccgctctg
ttccagaccctgctgcagcagtcgtgcttgattcccgccctgagctcgtatctgcgcaac
gattccgttctggacataactcgacacattccgctgtatcgtgccatactgaagctgctg
cgcgccctctcgctgtccaagtctctcgtctcgctgctccagccggcgcccagcgcctgc
ggcgagggcacacaatccatcgctgagctgctgacgaacatgaagacctgcgtggacacg
tatgccaagcgtctaaaagtcaacaagaagtcgaacatcaagggccagacgcagcaattg
acattcaacattgacgatggcgatgacgagggactggcactgctcataccggacatacag
gagacgagtgtgctggtgcagaagaccaccgatgccgatgccctgatcaacatgcagagc
agcagcgaggacggcagcggccagctggaacgtcccttgagcaagtcggtcgaacagcgc
tatttggagctgatgaagaagcggcagttcgacacgttcgacatgattgtcgagtcggag
aacaatagctttcggtttgtggtgtcgcatcattttgagaaaatggtgcgactggcaggc
gatcgctatcatccgtcgcgggttaagcggctggctcaagaagcggtcactctgtccacc
agtctgcctctgagctacagcagctctgtatttgtgcgctgtgatacggacagattggat
gtgatgaaggtgctcattactgggccatcggacaccccgtatgccaatggatgcttcgag
ttcgatgtcttctttccgccagactatcccaatctgcccatgctcatcaatttggagacc
acgggccgccattcggtgcgtttcaatcccaatctctacaacgatggcaaagtgtgtctg
tcggtgctgaacacctggcatgggcgtcccgaggagaagtggaatgcgcagacctccagt
ttcctgcaggtgctagtctccatccaatcgctgatcctagtcccagagccgtacttcaat
gagcctggctttgagcgcagtcgtggcactcctagtggcaccaactcgtcgcgggagtac
aatagcaacatctatcaggcctgcgttcgctgggccatgctcgaacagatacgcaatccg
agtccctgcttcaaagacgtcatacataaacatttctggatgaagcgcgaggaggtctgc
acacagatcgagggctggattgaggagcttagtaagccccagtacacagagcgggctagc
cgcaccatatcgtttaactctatggttctgcgtcgacactatcgtcacttgcgcgaggag
ctggccaaattgaagccgccacgcggactggaggatctggatgcacctttcaatcctgtt
gccacgctgcccccaatggatgtctccgcggcgccagctgccacaaccacagcaaatgtc
caggtgggaacggatggtcctattgttccggaactgaatctaataacagatgatggggac
gacagcgacaatggcccttgcatcctggatccagtgtcgggcgtcctcaaaggcgtggag
gaagtggttgaaattctgagtgatacagagaacgagagcagtgtttggcaggagaaggaa
gaggaggaggaggacgaaggcgacgtcgacggcgatggcgatggcgacggtgatggcgag
gaggagtaa

KEGG   Drosophila persimilis: 6588227
Entry
6588227           CDS       T01063                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
dpe  Drosophila persimilis
Pathway
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    6588227
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6588227
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpe03036]
    6588227
Peptidases and inhibitors [BR:dpe01002]
 Peptidase inhibitors
  Family I32: IAP family
   6588227
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     6588227
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    6588227
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 6588227
NCBI-ProteinID: XP_002012902
FlyBase: FBgn0161266
UniProt: B4G6D0
LinkDB
Position
Unknown
AA seq 152 aa
MDATAATDATGAVVGDKLEMFRQLNLLEQHRVESFKDWPFPEQSSCSISKMAEAGFYWTG
TKRENDTATCFVCSKTLDGWESDDDPWKEHLKHAPQCEFVKLGCAEKDLTVTQFLEILGR
VVKTSIEKNCKAFKQSFISDNENSLDKFTHNK
NT seq 459 nt   +upstreamnt  +downstreamnt
atggatgctacggcggcaactgatgctacgggggcagtggttggggacaagctggagatg
ttccggcaactaaatttgttggagcaacatcgtgtggagagtttcaaggactggcccttc
cccgagcagtcgtcctgtagtatatccaagatggctgaggcgggcttctattggacgggc
acaaagcgggagaatgacacggccacatgcttcgtatgcagcaaaaccctggatggctgg
gagtcggacgacgatccctggaaggagcatctgaagcacgccccgcaatgcgaattcgtc
aagctaggatgtgcggaaaaggatttgacggtgacacaatttctagaaatactgggccgt
gtggtcaagaccagcatagagaagaattgtaaagccttcaagcagagctttattagcgat
aacgaaaacagtctggataagtttacgcataacaaataa

DBGET integrated database retrieval system