KEGG   Drosophila persimilis: 6588227
Entry
6588227           CDS       T01063                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
dpe  Drosophila persimilis
Pathway
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    6588227
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6588227
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpe03036]
    6588227
Peptidases and inhibitors [BR:dpe01002]
 Peptidase inhibitors
  Family I32: IAP family
   6588227
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     6588227
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    6588227
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 6588227
NCBI-ProteinID: XP_002012902
FlyBase: FBgn0161266
UniProt: B4G6D0
LinkDB
Position
Unknown
AA seq 152 aa
MDATAATDATGAVVGDKLEMFRQLNLLEQHRVESFKDWPFPEQSSCSISKMAEAGFYWTG
TKRENDTATCFVCSKTLDGWESDDDPWKEHLKHAPQCEFVKLGCAEKDLTVTQFLEILGR
VVKTSIEKNCKAFKQSFISDNENSLDKFTHNK
NT seq 459 nt   +upstreamnt  +downstreamnt
atggatgctacggcggcaactgatgctacgggggcagtggttggggacaagctggagatg
ttccggcaactaaatttgttggagcaacatcgtgtggagagtttcaaggactggcccttc
cccgagcagtcgtcctgtagtatatccaagatggctgaggcgggcttctattggacgggc
acaaagcgggagaatgacacggccacatgcttcgtatgcagcaaaaccctggatggctgg
gagtcggacgacgatccctggaaggagcatctgaagcacgccccgcaatgcgaattcgtc
aagctaggatgtgcggaaaaggatttgacggtgacacaatttctagaaatactgggccgt
gtggtcaagaccagcatagagaagaattgtaaagccttcaagcagagctttattagcgat
aacgaaaacagtctggataagtttacgcataacaaataa

KEGG   Drosophila persimilis: 6603157
Entry
6603157           CDS       T01063                                 

Definition
(RefSeq) death-associated inhibitor of apoptosis 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
dpe  Drosophila persimilis
Pathway
dpe04120  Ubiquitin mediated proteolysis
dpe04215  Apoptosis - multiple species
dpe04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6603157
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    6603157
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    6603157
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6603157
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dpe04121]
    6603157
Peptidases and inhibitors [BR:dpe01002]
 Peptidase inhibitors
  Family I32: IAP family
   6603157
Ubiquitin system [BR:dpe04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    6603157
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4
Other DBs
NCBI-GeneID: 6603157
NCBI-ProteinID: XP_002028172
FlyBase: FBgn0153864
UniProt: B4HBE3
LinkDB
Position
Unknown
AA seq 493 aa
MTELRLELESVRTATFVQWPLNAPVSAEDLVTNGFFATGNWLEAECNWCHVRIDRWEYGD
QVAERHRRCSPICSMVLAPSHCGNITLSQENDSEGNTMVDGGGTASPCACPDLHLEANRL
ETFKDWPNPNVTPQALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFDEHRRFFPNCP
RVQMGPLIEFAAGKNLEELGIQPTTQPKLPNFACVDSRLRTFTDWPIGNIQPPEPLAQAG
LFYQKIADQVRCFHCNIGLRSWQKEDEPWHEHAKWSPKCQFVLLAKGPTFVREVGEAMAA
SSGSQIATAPALQLNALMDESPAKEALALGINGGVLRNTIQRKLSSSGSAFETLDELLHA
IFDEAGCETALEVREPTEPTAPPLDCCQATTSKAAVSSDSMQNKAEPSVVPEANISEQMQ
RMSVAPPNGNISLEEENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPLC
RADIKGFVRTFLS
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgacggaacttcgactggagctggagagcgtacgcacagccacatttgtgcaatggcct
ctgaatgcccccgtcagtgccgaggatttggtgacgaatggtttctttgccacggggaat
tggctggaggcggagtgcaactggtgtcatgtgcgcatcgataggtgggagtacggggat
caagtggccgaaagacatcgacgctgctccccaatttgctccatggtgctggcccccagt
cactgcggcaatatcacgctgagtcaggagaatgacagcgaaggcaacaccatggtggat
ggcggcggtactgcctccccatgtgcctgtcctgatcttcacctggaagcgaatcgcttg
gagacattcaaggactggccaaatcctaacgttacgcctcaggctctggccaaggctggt
ttttactatctaaatcgcttggatcatgtcaagtgcgtatggtgtaatggcgttatagcc
aagtgggagaaaaacgacaacgccttcgacgagcatcgacgcttcttccccaactgtccg
cgtgtccaaatgggaccgcttatcgaatttgccgctggaaagaatctggaagagctggga
attcagcccacaacccagccgaaacttccaaacttcgcctgcgtggactcgcgactgcgc
acgttcaccgactggcccattgggaacattcagcctcccgagccactcgcccaggcaggt
ctcttttatcagaagatcgctgatcaggttcgctgcttccactgcaacattggtctgcgc
tcctggcagaaggaggacgagccctggcacgagcacgctaaatggtcgcccaaatgtcag
tttgtgctgctggccaagggaccaacctttgtgcgtgaggtgggtgaggctatggcggca
tcgtctggatcccagatagcaacggctcctgctctccagctgaatgccctaatggatgag
agcccggccaaagaagccctcgccctgggcataaacggaggagtgttgagaaacactatt
caacgcaagctttccagttcaggctctgctttcgaaacactggatgaactgctgcatgcc
atcttcgacgaggctggttgtgaaacagccctcgaggtgcgggagccaacagagccgact
gcaccgccccttgattgctgtcaggcaaccaccagcaaagcggcagtatcctccgattcc
atgcagaacaaggcagagccgtctgtcgttcccgaggcgaacatctcggagcagatgcag
agaatgtctgtggcaccgccaaatggcaacatttcactggaggaggagaaccgtcagctg
aaggacgcccgtctgtgtaaagtgtgtttggacgaggaggttggggtggtgttcctaccc
tgcggtcacttagcgacatgcaatcagtgcgctcccagcgtggccaactgtcccttgtgc
cgcgccgacatcaagggatttgtgcgcacatttctatcgtaa

DBGET integrated database retrieval system