KEGG   Drosophila persimilis: 6588586
Entry
6588586           CDS       T01063                                 

Definition
(RefSeq) fas-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
dpe  Drosophila persimilis
Pathway
dpe04215  Apoptosis - multiple species
dpe04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    6588586
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    6588586
SSDB
Motif
Pfam: Death DED
Other DBs
NCBI-GeneID: 6588586
NCBI-ProteinID: XP_002013221
FlyBase: FBgn0161601
UniProt: B4G312
LinkDB
Position
Unknown
AA seq 241 aa
MPGNHWYDILKKIACEGSSDIDQLKGIFEKELSKRKFDSIRNIEDLIDVLERADMLSLDN
VEPLRKMSSHNPKLIEALDRYGTLVSAPREPINIYQEERLAEELRQHLRISQAFQIVSAP
RVAPPAFIRAAAPTPPPPQQNYVTPAAFTDRKRTAVFNKISEELGRFWRIFGRKAGIGEG
TMDDIEERYPRDLKSRILHLLKLIEEDDCHDPRQFLMRLCRALTECGRNDIKRKVEQIMS
H
NT seq 726 nt   +upstreamnt  +downstreamnt
atgcctggaaatcattggtacgatatactaaagaaaatagcctgtgaaggctcttcggac
attgaccagctgaaggggatctttgaaaaggaactttcaaagagaaaattcgactctatt
cggaatattgaagatctaattgatgttctggaacgtgcggatatgttgagcctggataat
gtcgagcccctccgcaagatgtcctcccataacccgaaactgattgaagccctggacagg
tacgggaccctcgtgtcggctcctcgggaacccatcaatatctatcaagaagaacgactg
gctgaggagctgcggcaacacctacgcattagccaggctttccaaatagtgtcggctcca
agggtagcacctccagcattcatccgtgctgctgcccctacgccgccaccgccacagcag
aactacgtgacaccagctgcatttacggatcgcaaacgcacggctgtttttaataagata
tctgaggaactggggcgattctggcgaatatttggacggaaggcgggcattggtgagggc
accatggacgacatcgaagaacgatatccccgtgatctcaaatctagaattttacatctg
ctgaagttgattgaagaggacgactgccatgacccacgacaattcctgatgcgtctctgc
cgagccctgacggaatgtggtcggaacgacataaaaaggaaggtggagcaaataatgtcc
cactaa

DBGET integrated database retrieval system