KEGG   Drosophila persimilis: 6588623
Entry
6588623           CDS       T01063                                 

Definition
(RefSeq) serine protease HTRA2, mitochondrial
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6588623
   04215 Apoptosis - multiple species
    6588623
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6588623
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dpe03110]
    6588623
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     6588623
Peptidases and inhibitors [BR:dpe01002]
 Serine peptidases
  Family S1: chymotrypsin family
   6588623
Chaperones and folding catalysts [BR:dpe03110]
 Other chaperones and cochaperones
  DegP / HtrA
   6588623
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ_2 Peptidase_S46 PDZ Tricorn_PDZ Hjc
Other DBs
NCBI-GeneID: 6588623
NCBI-ProteinID: XP_002013225
FlyBase: FBgn0161604
UniProt: B4G316
LinkDB
Position
Unknown
AA seq 427 aa
MALRCINNLEIFLRRCTAPTLHRCCVASSRTAHTASSSKGSGGDNSKDQENNGQNKSGYR
RFGWRSVFQFCVPFSLGALVSAVLIEGHRDELTPTISARSLKGRRNEFNFIADVVAGCGD
SVVYIEIKDTRHFDYFSGQPITASNGSGFVIEQNGLILTNAHVVINKPHTMVQVRLSDGR
TFPATIEDVDQTSDLATLRIHVSGLPVMKLGKSSTLRSGEWVVALGSPLALSNTVTAGVI
SATQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPI
DYVKVFLERAAERRKKGSAHKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPNNLMHGV
LVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALAEGRKDLEIVILRGVKQMHV
KITPEDP
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcgctgcgatgtataaacaatctggaaatattcttgaggcgatgcactgcacccacg
ttacaccgctgctgtgtggccagcagcagaacagctcacacggccagcagcagcaaaggc
agcggcggcgacaatagcaaagaccaagagaataatggccagaataagtccgggtacaga
aggtttggctggcgtagtgtttttcagttctgtgtgcccttctccctgggtgctctagtc
agtgccgtactgatagaaggacatagggacgaactcacaccaacgatctcagcgcgttcg
ctgaaaggacggcgaaatgaattcaacttcatcgctgacgtggtggccggctgtggagac
tccgtggtgtacattgagattaaggacactcgccacttcgactacttcagtggtcagccc
ataacagcgtccaacggatcggggtttgtgatcgagcagaacggtctcattctgaccaat
gcccatgtggtcatcaacaagccgcacacgatggtgcaggtgcggctgtcggacggacgc
acctttcccgccacaatcgaggacgtggaccagacctccgacctggccacgctgcgcatt
catgtcagcggcctgcccgtgatgaagctcggcaaaagcagcaccctgcggtccggcgag
tgggtcgtggccctgggcagccccctggcgctgagcaacacggttactgccggcgtcatt
agtgccacgcagcgcgcctcccaggagctggggctgcgcaaccgcgatatcaactacctg
cagacggacgcggccattacctttggcaactctggggggccgctggtgaatctggatggc
gaggccattggcgtcaactcaatgaaggtcaccgctggcatcagctttgccatacccatc
gactatgtaaaggtgttcctcgagcgggccgcggagcgtcgcaagaagggatctgcccac
aaaacgggatatccggtcaagcgatacatgggcatcaccatgctgaccctcacgcctgac
atactgttcgagctgaagtcccgcagtcagaacatgcccaacaatctgatgcacggcgtg
ctggtctggaaggtcattgtgggctcaccggcacacagtggcggtctgcaaccaggcgac
attgtcacccacattaacaagaaggagatcaagaactcctcggacgtgtatgatgccctg
gccgaaggcagaaaagacctggaaatcgtcatcttgagaggcgttaagcaaatgcatgtg
aaaatcacaccagaggatccctag

DBGET integrated database retrieval system