KEGG   Drosophila persimilis: 6588648
Entry
6588648           CDS       T01063                                 

Definition
(RefSeq) caspase
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6588648
   04215 Apoptosis - multiple species
    6588648
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6588648
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     6588648
Peptidases and inhibitors [BR:dpe01002]
 Cysteine peptidases
  Family C14: caspase family
   6588648
SSDB
Motif
Pfam: Peptidase_C14 RNase_H_2
Other DBs
NCBI-GeneID: 6588648
NCBI-ProteinID: XP_002013216
UniProt: B4G307
LinkDB
Position
Unknown
AA seq 348 aa
MENTMADPNTNNSSSNESTDQVGIRVENENPDDHTDAFGSVGGSSGTAAASSSSHHNNIY
GSGAIGQLANGYKSPSSSYGKNVAKMVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKS
RAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDIVRTIELAASQNHGDSDCILVAILSHGE
MGYIYAKDTQYKLENIWSFFTANHCPSLAGKPKLFFIQACQGDRLDTGVTMQRGHTETDG
DSSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCVELAANGKRLDILTLLTFV
SQRVAVDFESCTPDTPEMHQQKQIPCVTTMLTRILRFSDKQLVPAGRV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggaaaatacaatggccgacccaaacacaaacaatagcagcagcaacgagtccaccgat
caggtaggaattcgcgtggaaaacgaaaacccggacgatcacacagacgcctttggatct
gtgggtggcagcagtggcacagctgcagcctcgagttcctcgcatcacaacaacatctac
ggtagcggagccattggtcagctggccaatggctataaatccccctcttcgagttatggc
aaaaatgttgcaaaaatggtcacggaccgtcatgctgcagagtacaatatgcgacacaaa
aatcgtggcatggctttgatctttaaccatgagcacttcgaggtgcccactttgaagtcg
cgtgcaggcaccaacgtggactgtgagaatctgacccgagtgctgaaacagctcgatttt
gaagtgaccgtctacaaggactgtcgctacaaagacattgtacgtacaattgaattggcg
gcctcgcagaatcacggcgatagcgactgcattttggtggcgattctatcgcacggagag
atgggctacatctatgccaaagacacccaatacaagctagagaacatctggagcttcttc
acggccaatcactgcccctcgctggctggcaagccgaaactgttcttcatccaggcctgc
cagggcgaccgattggacacgggagtgaccatgcaacgaggacataccgaaaccgatggc
gactcatccatgagctacaagatacccgtacatgccgatttcctcattgcctactcgacc
gtccccgggttttactcgtggcgcaacaccactcggggaagctggttcatgcagagcctg
tgcgtcgagctggctgccaatggcaagcgcctggacatactaacgctgctgaccttcgtc
tcgcagcgtgtggccgttgactttgagtcatgcacccccgatacacccgagatgcaccag
cagaagcagatcccctgcgttaccacgatgctaacgcgcattttgcgtttcagcgataag
caattggtccccgccggacgagtttga

KEGG   Drosophila persimilis: 6598605
Entry
6598605           CDS       T01063                                 

Definition
(RefSeq) caspase-3
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6598605
   04215 Apoptosis - multiple species
    6598605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6598605
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     6598605
Peptidases and inhibitors [BR:dpe01002]
 Cysteine peptidases
  Family C14: caspase family
   6598605
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 6598605
NCBI-ProteinID: XP_002023850
FlyBase: FBgn0164876
UniProt: B4GZ35
LinkDB
Position
Unknown
AA seq 308 aa
MDDTDFSLFGQKNKHKKDKADATQIAKTPTSEADLKRIIISRPTVDDTYENCQRAGIAVI
LNHKDVKGQKQRVGTERDRDDMQHTLQTFGFDVRTYNDLTFSDINDMLKEVAREDHSDND
CFVLVVMSHGTEGKVYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGENLEKAV
EFTSFAVMTRSLAPAEAAPVQPITYAIPSTADMLVFYSTFDKFFSFRNVDDGSWFIQSLC
RVLDMAAFNEAGQPDGVDLLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTKTF
QLRVKPKT
NT seq 927 nt   +upstreamnt  +downstreamnt
atggacgacacggacttttcgctcttcggccagaagaacaagcacaagaaagacaaagcg
gatgccacacagatcgccaagacgcccacatcggaggcggatctgaagcgcatcatcatc
tccaggcccaccgtcgatgacacctacgagaactgtcaacgcgccggcatcgcggtgata
ctcaatcacaaggacgtcaaggggcagaagcagcgcgtgggcaccgaacgggatcgcgat
gacatgcagcacaccctgcagacctttggcttcgatgtgaggacctacaacgatctgacc
ttctccgatatcaacgatatgctcaaagaggtggcacgcgaggatcatagcgataatgat
tgcttcgttctcgttgtcatgtcccatggcactgagggcaaggtctatgccaaggacatg
tcctatccggtggagcggctgtggaaccccttcctgggcgacaactgcaagaccctgaag
aacaagccgaagctcttcttcatacaggcctgccgtggcgagaatctggagaaggcagtg
gagttcacctccttcgcggtgatgaccagatctctggcccccgccgaagcggcgccggtc
caaccgattacgtatgccatacccagcacggcggacatgctcgtcttttactccaccttc
gacaaatttttctcatttcgcaatgtggacgatggctcgtggtttattcagagtttgtgc
cgagtcctggacatggccgcctttaacgaggctggccaacccgacggcgtcgatctgctg
cgcctgctgaccgccgtcaacaggaaggtggcctacgagtaccagtcgaatacgaagaac
gaggccctcaaccaaatgaaggaaatgcccaactttatgtccacactcaccaaaactttc
caattgcgtgtgaagccaaagacctga

DBGET integrated database retrieval system