KEGG   Drosophila persimilis: 6589079
Entry
6589079           CDS       T01063                                 

Definition
(RefSeq) cytochrome c-2
  KO
K08738  cytochrome c
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6589079
   04215 Apoptosis - multiple species
    6589079
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Other DBs
NCBI-GeneID: 6589079
NCBI-ProteinID: XP_026844909
LinkDB
Position
Unknown
AA seq 108 aa
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt   +upstreamnt  +downstreamnt
atgggcgttccagctggtgatgttgagaagggcaagaagctgttcgtgcagcgttgcgca
cagtgccacaccgtggaggctggtggcaagcacaaggttggtcccaatctgcatggtctg
atcggtcgcaagactggccaggctgccggtttcgcatacacggacgccaacaaggccaag
ggaatcacctggaatgaggataccctcttcgagtacctggagaaccccaagaagtacatc
cccggcaccaagatgatcttcgccggtctgaagaagcccaatgagcgcggtgatctgatt
gcctacctgaagtctgccaccaagtaa

KEGG   Drosophila persimilis: 6589080
Entry
6589080           CDS       T01063                                 

Definition
(RefSeq) cytochrome c-1
  KO
K08738  cytochrome c
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6589080
   04215 Apoptosis - multiple species
    6589080
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 6589080
NCBI-ProteinID: XP_026844505
FlyBase: FBgn0156378
LinkDB
Position
Unknown
AA seq 105 aa
MGGGDADNGKKIFVQKCAQCHTVESGGKHKVGPNLSGIVGRKSGSAPGFKYTDANQKKGV
VWSDSTLDEYLKDPKKYIPGTKMVFAGLKKAEDRADLIAYLKKNK
NT seq 318 nt   +upstreamnt  +downstreamnt
atggggggcggtgatgcagacaacggcaagaagatttttgtacagaagtgcgcccagtgc
cacaccgtcgaatcggggggcaagcacaaggttggccccaatctaagcggcattgtggga
cgcaaatccggctctgctccgggcttcaaatacacagatgctaatcaaaagaagggcgtt
gtttggagcgattcgacgctggacgagtacctcaaggatccaaagaaatacatacccggc
actaagatggttttcgcaggactcaaaaaggccgaagaccgtgccgatttgattgcatac
cttaaaaaaaataagtaa

DBGET integrated database retrieval system