KEGG   Drosophila persimilis: 6589301
Entry
6589301           CDS       T01063                                 

Definition
(RefSeq) stress-activated protein kinase JNK isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dpe  Drosophila persimilis
Pathway
dpe04013  MAPK signaling pathway - fly
dpe04068  FoxO signaling pathway
dpe04137  Mitophagy - animal
dpe04140  Autophagy - animal
dpe04141  Protein processing in endoplasmic reticulum
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
dpe04310  Wnt signaling pathway
dpe04391  Hippo signaling pathway - fly
dpe04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6589301
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    6589301
   04310 Wnt signaling pathway
    6589301
   04391 Hippo signaling pathway - fly
    6589301
   04068 FoxO signaling pathway
    6589301
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6589301
   04137 Mitophagy - animal
    6589301
  09143 Cell growth and death
   04214 Apoptosis - fly
    6589301
   04215 Apoptosis - multiple species
    6589301
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    6589301
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpe01001]
    6589301
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     6589301
Protein kinases [BR:dpe01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   6589301
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like RIO1 APH
Other DBs
NCBI-GeneID: 6589301
NCBI-ProteinID: XP_002014392
UniProt: B4G7I8
LinkDB
Position
Unknown
AA seq 375 aa
MQIKMAAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTVTEQNVAIKKLSR
PFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEDFQDVYLVMELMDANLCQVI
QMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTT
FMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIE
QLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDALFPNDNNQNSRRKAADARDLL
SKMLVIDPEQRISVDKALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYE
EVMDYEAHNTNNRTR
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgcaaattaaaatggcagctcaacaccaacactataccgtagaagtaggggataccaat
tttactatccatagtcgctacattaacctaaggcccataggatctggtgcccaaggaata
gtatgtgctgcttacgacactgtcactgagcaaaacgtggccatcaagaagttatcgcga
ccattccaaaatgtaacccatgccaagagagcatatagagaattcaagctaatgaagctt
gtaaaccataaaaacattattggcttgcttaatgcttttactccgcaacgaaatttagag
gattttcaagacgtttaccttgtcatggagctaatggacgctaatctctgccaagtcatt
caaatggacttggatcatgacagaatgtcatatttgctatatcaaatgttgtgcggaata
aaacatttgcattcagctggaattatacatagagacttaaaaccatccaatatagtggtg
aaggccgactgtactctaaaaattttagactttggacttgcacgcactgcaggaactacc
ttcatgatgactccgtatgttgtaacacgctactacagggcaccagaagtcattttggga
atgggctatactgagaacgttgatatatggtccgtcgggtgcattatgggtgaaatgata
cgaggtggggtactctttcctggaacagatcatatagatcagtggaataaaattattgag
caattaggcacaccatctccatcatttatgcaacggttacaaccaactgtacgaaattat
gtggaaaatcgtcctcggtacactggatattcatttgatagactctttcccgatgcatta
tttccaaatgataataatcagaacagtcgaaggaaagctgcagacgccagagatctcctt
agtaaaatgcttgtaattgacccagaacagcggatatctgtagacaaggcattgaaacat
gaatatataaatgtctggtacgatgctgaggaagtagacgctcctgctccagagccgtat
gatcatagcgttgatgaaagagaacatactgtggaacaatggaaggagttaatttatgaa
gaagttatggactacgaggcacataacactaataatagaacacggtag

DBGET integrated database retrieval system