KEGG   Drosophila persimilis: 6590833
Entry
6590833           CDS       T01063                                 

Definition
(RefSeq) uncharacterized protein LOC6590833
  KO
K02084  apoptotic protease-activating factor
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6590833
   04215 Apoptosis - multiple species
    6590833
SSDB
Motif
Pfam: NB-ARC APAF1_C Hira CNH
Other DBs
NCBI-GeneID: 6590833
NCBI-ProteinID: XP_002016504
FlyBase: FBgn0148061
UniProt: B4GC51
LinkDB
Position
Unknown
AA seq 1489 aa
MDTDVNQMHYHYKDILSVFLDPFIEDFDCKDVEDSLRSILTKREIDFIFASDQTDVRIYL
LFWKLLEKPESIVKRFVEEVLNYRDGANYEFLMTPIKAEYLQPSPNTRLYVEQRDRLFND
NQVFSKYNVPRLKPFLDLTKALLELRPAKNVLVDGPLGAGKQWLVLDVCSSYKVQQKMDF
KIFWLNVKNCNSPEADLEMLLTLLYQIDPSWSSRCDSGTWNIMQRIDSVKIELRRLLKSK
PYENCLLVLRNVQSVRTWKAFNLGCKILLTTRYKCVTDYLSAATTKHVPLKDALTEHEAE
SLIVKYLHCRPEDLPREVLTTNPRSLSIIAESIRDGLATWENWKDVNCNKLTSIIESSLK
VLEPVINRNMFDKLFIFPPSAHIPIDLLSLVWSDDKSDSDDPMVVVNKLHRYSLVEKQAH
PSTISIPTIYLELKLRVTNAAALHRRIVDHYNITKAFDDDDDLTVPFLDGYFYCHIGHHL
TNLEHSESVALFRKIFLDFRFLEQKIRYDKTAWNASGSILNTLQQLKFYSSYIIDNDPKF
KRLVNALLDFLPKIEENLIRSKFTRLLRIALMDEEEAIYEEAHRQVQRFGDQVWFTEHGR
FHQHRQIINLGENTVRHVLYLNNDFCLMALDSKQMLLTDVSLEAEDTYLLKDDNDSSDIL
KMAVFNNQKHLLTLHSNGSVKLWSLWAECFGRRHSSGSRQRVRPPHLSHLRKYAATRTYK
QLVNGVAKRSMNSYQRAEQNIAAFYLNEEATVGDSKIQLHVAFSNGDVCICEWDDRDQVF
KSSNTPTLETHPLRVRCFVQVLNRYYVICTADCTLTVWDLHNGSCDKPELSGYDVHNDPP
LAIEVYNERSQHSNLLLIHRYSVWRLTFEPGDCQQPQVRLKSEPVQLPDMSFITCAKGSP
DGRYLILGTSVGLIVYDIQLSSPVLRSNVSEHIECVDIYELCDPIYKYIVLCGAKGKRLL
HVHTLRKVDSGITWVHNVDETKGMTRACLEPNVYLRPLLDMTRQRSQLLAIDSKERIHQI
ETTADPSARRRSSISSWSTITPTHAASKTRITAISAHDDDHIFVGYMDGVIIDVNRDAVL
PQQYITEPIDYLKQVNSQLLVASAHGPRKTVIFQLQPELPSLPVAGAAPVDWPLKLELDT
KYACLLGGKFLLLFSEHGVFQLDISNPLVLIKLENCDEPLMGFDLKNGLLFLAFGNNTIE
VSRFSFNDTGLRNDFICRKRITEEQKISYLIASDDASLFALGFQNGIIELYSLAASAIQL
VYSIKEVHEQCITQLRFSPCKLLLISCGEQLCFWNVTHMRNNQIESQLAIRRSRRHKRHS
VTQEDAVDAAPIVSDMSEPLPFVSHQPVRDTQPEVDLWRNKRGNAIRPELLACIKFVGNK
ANQFFTDAKFSQFYSIDDEGVYYHLQLLETNPHMPPSGSSMHLQMAERLASEMISDMQYA
NLSDIRIIDPTLTIAGIDDEGADVVGDLQPESSATSQAETPLVVDECSS
NT seq 4470 nt   +upstreamnt  +downstreamnt
atggacaccgatgtgaatcagatgcattaccattataaggatatattgtcggtgtttttg
gaccccttcattgaggactttgactgcaaggatgtggaggactcactgcgttcgatacta
accaaaagggaaatcgatttcatctttgcatcggatcaaacggatgttagaatctacctt
ttgttttggaaattgctcgagaagccagagagcatcgttaaaagattcgtcgaggaggtt
ctcaactatcgcgatggggccaactacgaattcctgatgacgcccatcaaagccgagtac
ctacagccgagccccaacaccaggctgtacgtagagcagcgggatcgtctgttcaatgac
aatcaagtgttttccaagtacaatgtgccgcgactaaaaccgttcctcgacttaaccaag
gccctgctggagttgaggccagccaagaatgtcctggtcgatggccccctgggcgccggc
aagcaatggctagtgctcgacgtttgctcctcgtacaaagtgcagcagaagatggatttt
aagatattctggctgaatgtgaagaactgcaacagccccgaggcagacctcgaaatgctg
ctcactctgctctaccagatcgatccgagctggagcagccgatgcgactccggcacctgg
aacatcatgcagcgtattgacagcgtcaaaattgaactccggcgcctgctcaagagcaag
ccatacgagaactgcctgctggtgctgcgaaatgtgcagagcgttcgcacctggaaggcg
ttcaatctcggctgcaagatactcctgaccactcgctacaagtgcgttaccgattacctg
tccgcggcgaccaccaagcatgtgccgctgaaggatgccctcaccgagcacgaggctgag
tcgctaattgtcaagtaccttcactgcaggccagaggatctgcccagggaagttctgacg
acaaatccacgcagcctgagcattattgccgagagtatacgcgacggcctggccacttgg
gagaattggaaagatgtgaactgcaataaactcacgagcattatcgagagctcactgaag
gtgctggagccggttataaataggaatatgttcgataagctcttcatattccctccgtcc
gcccacataccaatcgatctcctatctctggtttggtcagacgataaatcagatagcgac
gatccgatggtggtggtgaataagctgcaccggtactccttggtggaaaagcaggcccat
ccgtcgaccataagtatacccacgatatacttggagttgaaactgagggtgactaacgct
gctgcactccacaggagaatcgttgatcattacaacatcacaaaggctttcgacgatgat
gacgatctgacagtgcccttcttggatggctatttctattgccatatcggccaccatctg
accaatttggagcactccgagagcgtggctctattccgcaagattttcctcgattttcga
tttcttgaacaaaagatacgatacgacaagacagcgtggaatgccagcggatcgatactc
aacactttacagcagcttaaattctacagctcctacattattgacaatgatccaaagttt
aagcgcctggtgaatgctttgctggatttccttccaaagattgaggagaaccttatacgg
tccaagtttacccgccttctgcgaatcgctctgatggacgaggaggaggccatttacgag
gaggcccaccgacaagtgcagcggttcggtgatcaagtttggttcacagagcatggtcgc
tttcaccagcatcggcaaattatcaacctcggggagaatacggttcgacacgtcctgtac
ctgaacaatgacttctgcttgatggccctggacagcaaacaaatgctgctgaccgacgtt
tctctggaggcggaggacacgtatctgctgaaggatgacaacgacagcagcgacatcctg
aaaatggccgtgtttaataaccagaagcacctgctcacgcttcacagcaatggcagtgtg
aagctctggtcgctgtgggccgagtgctttgggcggcgtcacagcagcggaagtcgccag
cgtgtgcgaccgccacacctttcccatttgcggaaatatgcggcgactcgtacgtacaag
cagctggtcaacggcgtcgccaagcgctcaatgaatagctaccagagagcggaacagaac
attgcagcgttctacttgaacgaggaagcaaccgttggagactcaaagattcagctgcat
gtggccttcagcaacggcgacgtttgcatctgtgagtgggatgacagggaccaagtgttt
aagtcctccaacacgcccaccctcgagacgcatccgcttcgtgtgcggtgtttcgttcag
gtgctgaaccgctactatgtgatatgcaccgctgactgcaccctcaccgtttgggatctg
cacaacggttcgtgcgacaagccagagctcagtggctacgatgtccataatgacccaccg
cttgcgattgaagtctacaatgaacgtagccagcattcgaacctgctgctcatccacagg
tacagcgtgtggcggctgacgttcgaacctggcgactgtcaacagcctcaagtccggctc
aagtcggagcctgtgcagctgccggacatgagcttcattacctgcgctaagggatcgcca
gatggtcgctatctgatcctgggaacatcggttggcctcattgtgtatgacatccagctg
tccagtcccgtgctgcgcagcaatgtgagcgagcacatcgaatgcgtggacatctacgag
ctgtgcgatcctatttacaagtacatagtgctttgtggtgccaaaggaaagcggctcctg
cacgtgcacacactgcgaaaggtggattcgggtattacgtgggtccacaatgtggacgag
acaaagggcatgacacgggcttgcctcgagcccaatgtctatctgcgcccgctcctggac
atgaccagacagcggtctcaactgctggccatcgactccaaggagcgtatccatcagatt
gagaccaccgccgacccaagtgctcgccgcaggtccagtatttcgtcctggtcaacgata
acccccacgcatgcggccagcaagacacgcataaccgcaatatccgcccacgacgacgat
cacatatttgtcggctacatggacggggtgatcatcgatgtaaaccgcgatgcggtgctg
ccgcaacagtatattacggagcccatcgactacctcaagcaggtcaactctcagctgttg
gtggcatcggcgcacggtccacgcaaaactgtgatattccagctacaaccagagctgcca
tcgctgccagtggctggagcagcgccagtggattggccgctcaagttggagctggacacc
aaatatgcctgccttctgggtggaaagtttctgctcttgttctccgagcacggagtcttt
caactggatatatccaaccctctggtactcatcaaactggaaaactgtgacgaaccactt
atgggcttcgacctgaagaacggtctgctctttctggccttcgggaacaacaccattgag
gtctcccgattcagcttcaacgacacggggctaaggaacgatttcatctgcaggaaacgg
atcacagaggagcagaaaattagttacctgattgcctcagatgacgcttccctgtttgca
ctgggcttccagaatggcattatcgagctctactccctggcagcatctgccattcagttg
gtttacagcataaaggaagtgcacgagcagtgcatcacacagctacggttctcgccgtgc
aaactgttgctcattagctgcggggagcagctgtgcttctggaacgtgacccacatgcgg
aacaaccagatcgagtcgcagctggccataagacgcagccgccggcacaagaggcacagt
gtcacgcaggaggatgctgtcgatgcggctcccattgtttcggacatgtcagagccactg
ccatttgttagccatcaacccgttcgcgacacccagccggaagtagatctgtggcggaac
aaacggggcaatgccatacggccggagctgctggcttgcatcaagtttgtgggcaacaag
gccaaccagttcttcaccgacgccaagttctcgcagttctattcgatagacgacgagggc
gtctactatcatttgcaacttctggaaacaaatccccacatgccgccgagtgggtcgtcg
atgcatctgcagatggctgaacggctcgcaagcgagatgatcagtgacatgcagtatgcg
aatctgtcggacattcgaataattgaccccacattgacaattgcgggcattgatgacgag
ggagccgatgtcgttggggatttgcagccagagtctagcgcaacgagccaggcagagacg
ccgctggttgtcgacgaatgcagctcatga

DBGET integrated database retrieval system