KEGG   Drosophila persimilis: 6591266Help
Entry
6591266           CDS       T01063                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dpe  Drosophila persimilis
Pathway
dpe00020  Citrate cycle (TCA cycle)
dpe00190  Oxidative phosphorylation
dpe01100  Metabolic pathways
dpe01200  Carbon metabolism
Module
dpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpe_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6591266
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6591266
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     6591266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 6591266
NCBI-ProteinID: XP_002015799
FlyBase: FBgn0148863
UniProt: B4GDN2
LinkDB All DBs
Position
Unknown
AA seq 661 aa AA seqDB search
MSGIMRVPSILAKNAVVSMQRAAAIAGQRSYHITHGRQQATAANPDKISKQYPVVDHAYD
AVVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDDWKWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSLKFGKG
GQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRGVLALNLEDGT
LHRFRAQNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFVQFHPTGIYGA
GCLITEGCRGEGGYLINAKGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGVGPDKDH
VYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVIT
VDKDGKDIIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFGRACAKTIAEENKPGAAAP
TLKDTAGEASVANLDKLRFANGQITTADLRLKMQKTMQHHAAVFRDGPILKEGVSKMQEI
YKQFKDVKVVDKSLVWNSDLVETLELQNLLANAQMTIVGAEARKESRGAHAREDFKIRLD
EYDYSKPVEGQEKVPFEKHWRKHTLAWVCNDNGDVQLDYRNVIDTTLDNEVSTVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaatcatgcgtgtgccatcgattttggccaaaaatgcagtcgtctccatgcag
cgcgcagctgcaattgcagggcaacgtagttatcacataacgcacggtcgccagcaggcg
acggcagctaatccggataagatatcgaagcagtatcctgtcgtcgatcatgcctacgat
gcagttgtggtgggagccggcggtgctggtctccgggccgcttttggccttgtcgccgag
ggattccgcacggcggtgatcaccaaattgttccccacccgctcgcacacgattgccgcg
cagggcggcatcaatgcggcgctgggcaatatggaggaggacgactggaagtggcacatg
tacgacacagtcaagggatccgactggctgggcgatcaggatgctatacactacatgacc
cgggaggcacccaaggctgtcatcgagctggagaactacggcatgcccttctcccgcaca
caagacggaaaaatctaccagcgcgccttcggtggccagagcttgaaattcggcaagggc
ggacaggcgcatagatgttgtgctgtggcggatcgtaccgggcactccctgttgcacacc
ctctacggacagtcgctcagttacgattgcaactactttgtggagtactttgccctggat
ctgatcttcgaggatggcgagtgccggggcgtgttggcccttaacctggaggatggtact
ctgcaccgtttccgagcccagaacaccgtcattgccactggcggctatggccgtgccttt
ttctcctgcacctctgcccacacctgcactggcgacggcactgctatggtcgctcgacag
ggcctcccctctcaagacttggagtttgttcagttccaccccactggcatctatggagcc
ggctgcctcattaccgagggctgccgcggcgagggtggctacctgatcaatgccaagggc
gaacgtttcatggagcggtatgctccggtggcgaaggatctcgcctctcgggacgtcgtg
tcgcgttcaatgaccatcgagatcatggagggtcgtggtgttggccccgacaaggatcac
gtttacctgcagctgcaccatttgccacccaagcagctggccgagcgactacccggcatc
tcagagactgctatgatttttgccggcgtagatgtaacacgcgagccaatccccgtctta
cccacggtgcactacaacatgggtggtgtgccaaccaactatcgcggccaggtgatcacc
gttgacaaggacggcaaggatatcattgtccccggcctctacgctgcaggggaggcagcc
tccagctccgttcacggtgccaatcgtctgggtgccaactctctgctggatctggttgtt
ttcggacgtgcctgcgccaagaccattgccgaggagaataagcccggcgcagctgctccc
actctcaaggatacagctggcgaggcctctgtggctaacttggataagctgcgctttgcc
aacggccagatcaccactgccgatctgcgcctgaagatgcagaagaccatgcagcatcat
gctgctgtgttccgcgacgggcccatcctcaaggagggtgtgagcaaaatgcaggagatc
tacaagcaattcaaggacgttaaggttgtggacaagtccctagtctggaactcggatttg
gtcgagacgctggagctgcagaatctgttggccaatgcccaaatgaccattgtgggagcc
gaggcgcgtaaggagtcgcgtggtgctcacgcccgtgaagacttcaagatcaggcttgac
gaatatgattacagcaagcccgtcgagggacaggagaaggtgccctttgagaagcactgg
cgcaagcacacgctcgcctgggtgtgcaacgacaatggagatgttcagttggattacagg
aacgtaatcgataccacgctggacaacgaggtgtcaacggtgccgccagcgatccgctcc
tactaa

DBGET integrated database retrieval system