KEGG   Drosophila persimilis: 6592429
Entry
6592429           CDS       T01063                                 

Definition
(RefSeq) caspase-1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6592429
   04215 Apoptosis - multiple species
    6592429
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6592429
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     6592429
Peptidases and inhibitors [BR:dpe01002]
 Cysteine peptidases
  Family C14: caspase family
   6592429
SSDB
Motif
Pfam: Peptidase_C14 DUF4347
Other DBs
NCBI-GeneID: 6592429
NCBI-ProteinID: XP_002018241
FlyBase: FBgn0154474
UniProt: B4GHW0
LinkDB
Position
Unknown
AA seq 323 aa
MTDECITRNFIALGSNGTGVNRSSIGDSTDAKGCEGNNAGVGGATAAASIPPPSINNYVA
RMPVERYASEYNMNHKHRGQAIIFNHEFFEIPTLRARMGTNVDAEELRKTFKRLGFDVSV
HKDCKWQNIREQIEKAAALDHTDSDCLAIAILSHGEHGCIYANDVQYKLDQIWHYFTAKM
CPTLAGKPKLFFIQACQGDGLDEGVMLEKGVTETDGDSSMGYKIPVHADFLFSYSTIPGY
YSWRNINNGSWYMQSLIQELNSNAKKYDLLTLLTFVSQRVAIDFESNVPVTPMMDRQKQI
PCFTSMLTRILRFGDKPNGNKAG
NT seq 972 nt   +upstreamnt  +downstreamnt
atgactgacgagtgcataactaggaactttattgctctcggttcaaatggaacgggcgtc
aatcgcagcagcattggtgatagtaccgatgccaaaggctgtgagggcaacaacgccgga
gttggtggtgcaacggctgcagcgagtattcctcccccctcgatcaacaattatgtggcc
cgaatgcccgttgagcggtatgccagcgagtacaacatgaatcacaaacatcgcggtcag
gccattatattcaatcatgagttcttcgagatacctacgctgagggcgcgtatgggtacc
aatgtggatgcggaggagctgcgcaagacctttaagagattgggtttcgatgtgtcagtg
cacaaggactgcaagtggcagaacatacgcgaacagatcgagaaggccgccgcgctggac
catacggacagcgactgcctggccattgccatcttgtcgcatggcgagcatggctgcatt
tatgccaacgatgttcagtacaagctggaccaaatctggcactacttcactgccaagatg
tgccccacgctggcgggcaagccgaagttgttcttcatacaggcctgccagggtgatggc
ctggacgagggcgtgatgctagagaagggcgtgactgaaacggatggggactcgtctatg
ggctacaaaatacctgtccatgccgactttctcttctcctactcgacgataccaggctac
tattcctggcgcaatataaacaacggctcgtggtacatgcagtcactcatccaggagctg
aatagcaatgccaagaaatacgacctgctcacgctgctcacttttgtcagtcagcgcgta
gccatcgactttgagtcgaacgtgccggttaccccaatgatggatcgccagaagcagata
ccgtgcttcacctccatgctgacgcgtatactgcgcttcggcgacaaacccaacggcaat
aaggctggctga

DBGET integrated database retrieval system