KEGG   Drosophila persimilis: 6593013Help
Entry
6593013           CDS       T01063                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X3
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dpe  Drosophila persimilis
Pathway
dpe00010  Glycolysis / Gluconeogenesis
dpe00030  Pentose phosphate pathway
dpe00051  Fructose and mannose metabolism
dpe00052  Galactose metabolism
dpe01100  Metabolic pathways
dpe01200  Carbon metabolism
dpe01230  Biosynthesis of amino acids
dpe03018  RNA degradation
Module
dpe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6593013
   00030 Pentose phosphate pathway
    6593013
   00051 Fructose and mannose metabolism
    6593013
   00052 Galactose metabolism
    6593013
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    6593013
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpe01009]
    6593013
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dpe03019]
    6593013
Enzymes [BR:dpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     6593013
Protein phosphatases and associated proteins [BR:dpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6593013
Messenger RNA biogenesis [BR:dpe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     6593013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 6593013
NCBI-ProteinID: XP_002018254
FlyBase: FBgn0155213
UniProt: B4GHX3
LinkDB All DBs
Position
Unknown
AA seq 788 aa AA seqDB search
MNSEINQRFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKAYFIREGYQGM
VDGGDNIQEANWASVSSIIHRGGTIIGSARCADFRERAGRLKAANNLVQKGITNLVIIGG
DGSLTGANLFRQEWSSLLDELVKNGSITAAQQEKNSVLHIVGLVGSIDNDFCGTDMTIGT
DSALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLALVAGLSSEADFIFIPEMPPKVD
WPDRLCTQLAQERSAGQRLNIVIVAEGAMDREGNPITAEDVKKVIDERLKHDARITVLGH
VQRGGNPSAFDRILACRMGAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAV
AKAMKEKRWADAVKLRGRSFERNLETYKMLTRLKPPKECFDAAGKGIEGYRLAVMHIGAP
SCGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVVPATISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKACENYSTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAEQIKANINANGEITCKAPDTATL
LGIVSRQYRFTPLVDLIGETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECATDAVA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaactccgaaattaatcaacgttttctggcccgcggctcgcagaaggacaaggggctg
gcagtcttcaccagcgggggggactcccagggcatgaatgccgctgtgcgtgcatgtgtg
cgtatggccatatatttgggatgcaaggcctacttcatccgcgaaggctaccagggcatg
gtagatggcggtgacaatattcaggaggccaactgggcctcggtgtcctccatcatccat
cgcggcggcactattattggctccgcccgctgtgcggatttccgtgaacgcgcaggccgc
ctcaaggccgccaacaacctggtgcagaagggaatcaccaacctggtgataattggcggt
gatggctcccttaccggcgccaatctgttccgtcaggagtggtccagcctgttggatgag
ctggtgaagaatggcagcatcactgccgcccagcaggagaagaacagtgtgttgcacatc
gtgggattggtcggctctattgataacgatttctgtggcacggacatgaccattggtacg
gactctgcactgcatcgcatcatcgaggctattgacgccatttcaagcacggcctactca
catcaacgcaccttcattatggaggttatgggtcgtcattgcggttatttagcacttgtt
gccggattgtctagtgaagctgatttcatattcattccggaaatgcccccgaaagtcgat
tggccagataggctgtgcactcaattggcccaggaacgatcggctggccagcgtttgaac
attgtcatcgtggctgagggtgctatggaccgtgagggaaatccaattaccgctgaggat
gttaagaaggtgatcgatgaacgcttgaagcacgatgcacgcatcacggtcctcggtcat
gtccagcgcggcggcaatcccagcgccttcgatcgtattttggcatgccgcatgggcgcc
gaggcgactttggctctgatggaggccactaaggattctgtgcctgtggtcatctctttg
gatggcaatcaggccgtgcgtgtgccgttgatggagtgtgtggagcgcactcaggcagtg
gccaaggccatgaaggagaaacgctgggcggatgccgtcaagctgcgtgggcgctccttc
gagcgcaatctggagacatacaagatgttgacccgcttgaagccaccaaaggagtgcttc
gatgccgcaggcaagggcatcgaggggtacaggctagcagtcatgcacattggtgccccc
tcttgtggcatgaacgcggccgtgcgcagtttcgtgcgcaatgccatctatcgtggcgac
gttgtctatggcatcaacgacggtgtcgagggtctcattgctggcaatgtacgtgaattg
ggatggtcggatgtgagtggatgggtgggacagggcggcgcctatctgggcaccaaacgc
accctgcccgagggaaagttcaaagagattgctgctcgtttgaaggaattcaagatccag
ggtctcctcatcatcggtggattcgagagttaccatgccgccggacagatcgccgatcag
cgcgataactatccacagttctgcatcccgatcgtggtcgtacccgcgacgatttcaaac
aatgtgcccggcacagagttctcgctcggctgcgacacgggtctgaatgaaatcacggag
atttgcgaccgtatccgccagtcggcccagggcacgaagcgtcgtgtgttcgttatcgag
acaatgggcggatattgcggctatttggctacgctggctggtctggccggtggtgcggat
gccgcgtacatttacgaggagaagttctccatcaaggacctgcagcaggatgtctaccac
atggccagcaaaatggccgagggcgtttctcgaggtctgatcctgcgcaacgagaaggct
tgcgagaactatagcacagacttcatctatcgcctgtactcggaggaaggcaagggtctc
ttcacctgccgtatgaacatcctcggccacatgcagcagggaggatcgcccacacccttc
gaccgcaacatgggcacgaagatggcggccaagtgcgtcgactggttggctgagcagatc
aaggcgaacatcaatgccaacggcgagatcacctgcaaggctcctgacaccgccactttg
ctgggcattgtgtcgcgtcaataccgcttcactccactcgtcgatctcattggggagaca
aactttgatcaacgcataccaaagaagcaatggtggctgcgtctgcgtccgcttctgaga
atccttgccaagcacgactctgcctacgaggaggagggtatgtacatcaccgtcgaggag
gaatgcgccaccgatgccgttgcctag

DBGET integrated database retrieval system