KEGG   Drosophila persimilis: 6593540Help
Entry
6593540           CDS       T01063                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dpe  Drosophila persimilis
Pathway
dpe00230  Purine metabolism
dpe01100  Metabolic pathways
dpe04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6593540
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    6593540
Enzymes [BR:dpe01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     6593540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF412
Motif
Other DBs
NCBI-GeneID: 6593540
NCBI-ProteinID: XP_002018727
FlyBase: FBgn0163379
UniProt: B4GJV7
LinkDB All DBs
Position
Unknown
AA seq 1194 aa AA seqDB search
MPEEKEMSGNNLENGQAMATATATATANSTPSRSKQQRQKTPTRRRPHDSDVVAGGVGIT
GGGVVILPQHVLNELYHNYSIKQRRSGLKWFLFAAVLFNVWTICIPWDQAIPTRVVNCCM
LVAYLALTALMHIGRRSEQPSLRRFHLTFLTIMPRALWFLSVLHFAAYVMLQPSFSPRDV
LGWAILLNFLIYVTLPLPLIFLGLVIGFCTYFNCLSLPVGFSRPDPLISDQAAANAVLIA
TAALIGLLYYFMGEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMRED
LGSSSSEAFKKIYMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKY
QQLRIKILGDCYYCISGAPDERPDHAVMCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTG
AVLAGILGQRQWQFDVYSKDVELANKMESSGMAGRVHISDKTLAFLNGEFEVEPAFGEKR
EELLRIAGLKTFFITKVVKPFASPCAKKINETQAENSQLSPNGSTTDVVSGGGEDNDATL
DDEELLAQSATTNGHQTAEAEDEEEQVKLENFKQRLKDELVTRDGHENLTKDTNIFLRFK
NPQLEQSYAVYREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVV
ISIAESFSGMLPKFFVDVSKRFNDITFVRELAAIIIALTIGLSNVIDMFFFVTFVRTEHI
VSESEFNATAGLGLGLGLGLEADVDVDVAGAEAVTAEHLLPESFVEQMRDAVPTERVLYP
SYLSNFGVLILIAIAVIAQLTHLTKILLLLSIAALHCYFNIFIMQDLYALEDDLAHQPII
SSRYCASGLLLVAALALSTLARHMDHEDRVIFKWKTEVAEQKETANDMRQRNEALVYNVL
PVHVAEHFMKNTKRSHDDLYSQSYSEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEV
ISDFDALLELPQFQDIIKIKTIGSTYMAASGINLQRNLRSDASITERWAQLAVLVEFALE
LTHTLQGINEQSFNHFVLKMGINHGPITAGVIGARKPHYDIWGNTVNVASRMESTGKAGA
IQVTEETCNILQKFGYTFQQRGLVSVKGKGQLMTYYLQGKSKPCAEPEATPAAIELHDTL
DSTTELDISDIKTPLLKLKGQEAPAAGESEQSGPAPSLGNGSVGQVGESQSLLE
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggagaaggaaatgtccggaaataatctggaaaacggacaggccatggccacg
gctacggctacggccacggccaactcaacgccaagcaggtccaagcaacagcgccagaag
acgcccacaaggcggcgtccccatgatagtgatgtggtcgctggaggcgttggcatcacc
ggcggcggcgtggtcatcctgccgcagcatgtgctcaacgaactctatcacaactactcc
attaagcagcggcggagcggcctcaagtggttcctgttcgccgccgttctcttcaatgtc
tggaccatttgcataccctgggatcaggcaatacccacaagagttgtaaactgttgcatg
ctggtggcctatttggccctaacggccctgatgcacatcgggcgacgctcggagcagcct
tcactgagacgtttccatctaacattcctgacgattatgccgcgggctctttggttcctg
tccgtgctccactttgccgcctatgtgatgctgcagcccagcttctctccaagggatgta
ctgggctgggccatcttgctaaacttcctgatctatgtgacgctgccgcttcctctgatt
ttccttggtctggtgattggcttctgcacgtacttcaattgcctgagcctccccgttggc
ttctctcgtcctgatcctctcatctcggatcaggcggcggccaatgcagttctgatagcc
accgccgccttgatcggtctactgtattactttatgggcgaggccaagcagaagcgagcc
tttttggaggccaaaaagagtctggaggtgaaaatggtcatcgaggaacagtccgccgaa
caggaacgtttactgttgtctgtgctgcccaagcatgtggctatcaaaatgcgcgaggac
ctgggctcatccagttcggaggcattcaaaaagatatacatgagtcgacacgagaatgtg
agcatactatatgcggatatagtgggctttaccgccatctcctcgacatatagcgctcaa
gacttggttaaaatgcttaacgagctcttcgcacgcttcgataggctcgccgagaaatat
caacaattgcgcattaagattctgggcgattgctattattgcattagcggtgcccccgac
gagcgaccggatcatgcggttatgtgtgtgcacatgggactctctatggtgaaggccatc
aagtatgtgcagcagaaggccaattcacctgttgatatgcgtgttggcatacacacgggc
gctgtgctggcagggatactcggccagcggcaatggcagtttgatgtctactccaaggac
gttgagctggctaataaaatggaatccagcggcatggcgggacgcgttcacatttcggac
aaaactttggccttcctcaacggggagtttgaggtggagcccgcctttggcgaaaagcgg
gaggagctattgcgcatagccggattgaagaccttcttcataaccaaggtggttaagccg
tttgcgtcgccctgtgccaagaaaatcaacgaaacgcaagccgaaaactcacaacttagc
cccaatggatccaccaccgatgtcgtttccggtggcggagaggacaacgatgccacgctg
gacgatgaggaactgctggcccagagtgccaccacgaatggccaccaaacagccgaggca
gaggatgaggaggaacaggtcaagctggagaactttaagcagcgcttgaaagacgagctc
gtcactcgagatgggcatgagaacctcaccaaggacaccaacatattcctgcgcttcaag
aacccacaattggagcaatcatatgccgtgtaccgagagccgtacagctccctgccgctg
ctggcggcactcctggtgcagtgcatcgacgtgctgtactcctacttggtgctgccccgc
tccacgctgcatttcatcaatatagcggcgccactggtgcccattgccatgctggtggtg
atcagcattgccgagagcttcagcggcatgctgcccaagttctttgtggacgtgagcaag
cgcttcaatgacattaccttcgtgcgggaactggcggccataattatcgccctcaccatt
ggcctgagcaatgtcatcgacatgttcttcttcgtcaccttcgtgcgcaccgagcacatt
gtgagcgaaagcgaattcaatgccacggctggtctgggtctgggactgggactgggtctg
gaggccgatgtggatgtggatgtggccggcgcggaggcggtcaccgccgagcacctgctg
cccgaatcgtttgtggagcaaatgcgcgatgcagtacccacagaacgtgtcctatatccg
tcctatttgagcaatttcggtgtcctaatattgattgcgattgccgtgattgctcagctc
acgcatctgactaaaatactcctattattgtccattgcggctttgcattgctacttcaac
atattcatcatgcaggacctgtatgccttggaggatgacctggcacatcagcccatcata
tcctcacgatactgtgcctctggtcttctgctggtggcagccctagctctgagcaccttg
gcccgacatatggatcacgaggatcgggtgatcttcaaatggaaaaccgaggtggcggaa
cagaaagagaccgccaacgatatgcggcagcgtaacgaggccttggtgtacaatgtttta
cccgttcatgttgctgaacatttcatgaagaataccaagcgatcgcatgatgatctctac
tctcagagctattccgaggtgggagtattatttgccagcatgccaaacttttcagatttc
tattcggaggaaaccgtgaataatcagggtctggagtgtctacgttttctaaatgaagtt
atctctgattttgatgcgttattggaactgccacagttccaggatatcatcaaaatcaag
acgattggctcgacttatatggccgccagtggcataaatcttcagcggaatcttcgctcg
gatgcttccatcaccgaacgctgggcccagttggccgtgctcgtcgaattcgcattggaa
ctcacgcacactctgcaaggcattaacgagcagtccttcaatcactttgtcctcaagatg
ggcataaatcacgggcccataaccgctggtgtgatcggtgctaggaagccgcactatgat
atctggggcaatacggtgaatgtggcatcccgcatggagagcactggcaaggccggcgcc
attcaggtcaccgaggaaacgtgcaacattctccagaagtttggctatacatttcagcaa
cgtggcctggtgtctgtcaagggcaagggccaattgatgacctactatttgcagggcaag
tctaagccttgtgcagagcctgaagccactccggcagccattgagctacatgatactctg
gattccaccacggagctggacatctcggacatcaagacgcccctgctcaagctgaagggc
caggaggcgccagcggcgggggagagtgaacagagtgggccggcgcccagtcttggcaat
ggcagtgtcggccaagtgggagaatctcaatctttattggaataa

DBGET integrated database retrieval system