KEGG   Drosophila persimilis: 6594625Help
Entry
6594625           CDS       T01063                                 

Definition
(RefSeq) short-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
dpe  Drosophila persimilis
Pathway
dpe00071  Fatty acid degradation
dpe00280  Valine, leucine and isoleucine degradation
dpe00410  beta-Alanine metabolism
dpe00640  Propanoate metabolism
dpe00650  Butanoate metabolism
dpe01100  Metabolic pathways
dpe01200  Carbon metabolism
dpe01212  Fatty acid metabolism
Module
dpe_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    6594625
   00650 Butanoate metabolism
    6594625
  09103 Lipid metabolism
   00071 Fatty acid degradation
    6594625
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    6594625
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    6594625
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     6594625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 F_actin_bind
Motif
Other DBs
NCBI-GeneID: 6594625
NCBI-ProteinID: XP_002019471
FlyBase: FBgn0149812
UniProt: B4GMN1
LinkDB All DBs
Position
Unknown
AA seq 405 aa AA seqDB search
MQSVLSRSLNIARRSVPMRQIASIAALPDTHQMLQKTCRDFANAELSPNAAKFDREHLYP
AQQIKQMGELGVMSVAIPEELGGTGLDYLAYAIAMEEISRGCASAGVIMSVNNSLYLGPL
LGFGNAAQKEAFITPYTTGERVGCFALSEPGNGSDAGAASTVATEKGDHYVLNGTKAWIT
NGFEAGAAVVFATTNKQLKHKGISAFIVPKGLKGFSLGKKEDKLGIRGSSTCQLIFEDCE
IPKDSMLGEPGFGFKIAMQTLDAGRIGIAGQALGIGQAALELAVDYAQKRQAFGKPISKL
QSIQQKIADMSLAMESARLLTWRAAWLKDNKQAYTKEAAMAKLAASEAATLCSHQCIQIL
GGMGYVADMPAERHYRDARITEIYEGTSEIQRLVIAGSILKEYAS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgtcctcagccgctccttgaatatagcacgcagatccgtgccgatgcgacag
atcgcctccattgccgcactccccgacacccatcagatgctgcagaagacctgccgcgac
tttgccaacgccgaactgagtccaaatgcagcgaaattcgatcgagagcatctgtacccg
gcgcagcagatcaagcagatgggggagctgggcgtcatgtcggttgccatacccgaggaa
ctaggtggcactggattggattatctggcgtatgcgatagccatggaggagatctctcgc
ggctgtgcctctgctggagtcatcatgtcggtcaacaattccctgtatctcggtccacta
ctgggctttggcaatgccgcccagaaggaagccttcatcacgccatacacgacgggagag
cgagttggatgttttgctctgtcggagccgggcaatggctcggatgccggtgctgcctcc
accgtagccaccgagaagggggatcactatgtcctcaatggaaccaaggcatggataacg
aatggctttgaggcgggagcagcagtggtatttgccacgacgaacaagcagctgaaacac
aaaggtatctctgccttcattgtccctaaaggcttgaaaggtttctcgctgggcaagaag
gaggacaaactgggcatcagaggatcctccacgtgccagctgatattcgaagactgcgaa
atccccaaggacagcatgctgggtgagccgggattcggtttcaaaattgcgatgcaaaca
ttggatgccggacgcattgggattgccggccaggcattgggtattggtcaggccgctttg
gagctggctgtggactatgctcagaagcgtcaggcctttggaaaacccatctccaaactg
cagtccattcaacaaaagattgccgacatgtcgctggcaatggaatcggcgcgactcttg
acctggcgtgccgcctggctgaaagacaacaagcaggcgtatacaaaagaggcggcaatg
gccaaattggcagcttctgaggcggctaccttgtgctcccaccaatgcattcagattctg
ggcggaatgggatatgtcgcagatatgccagcggaacgccattatcgcgatgctcgcatc
acggagatctacgagggcacctctgagattcagcgtttggttattgcaggctccattctc
aaggagtacgctagttaa

DBGET integrated database retrieval system