KEGG   Drosophila persimilis: 6595928
Entry
6595928           CDS       T01063                                 

Definition
(RefSeq) death-associated inhibitor of apoptosis 1
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
dpe  Drosophila persimilis
Pathway
dpe04120  Ubiquitin mediated proteolysis
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6595928
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    6595928
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6595928
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dpe04121]
    6595928
Peptidases and inhibitors [BR:dpe01002]
 Peptidase inhibitors
  Family I32: IAP family
   6595928
Ubiquitin system [BR:dpe04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    6595928
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_UBOX Rad50_zn_hook
Other DBs
NCBI-GeneID: 6595928
NCBI-ProteinID: XP_002020978
UniProt: B4GQU9
LinkDB
Position
Unknown
AA seq 439 aa
MANVLTNPRYMYGPTAALELTAVLDQVDNNTNATQLFKNNIYNIMNEYNREEARLKTFAN
WPLAWLDKHQLARTGMFYTNDNDKVKCYFCEVEIGRWDLDDQPVPEHLRWSPNCPLLRRR
TTNNVPLNSEALDRILPPISYDICGANDSTVELRESAYAEGRIPMSHIAQSIATNTAVSP
LMSSIATSTAATQANGDVHPESCRQVASGNYFPEHPEYAVESTRLRSFEEWPRNLKQKPM
QLAEAGFFYTGVGDRVRCFSCGGGLKDWDDNDEPWEQHALWLSQCRFVKLMKGQRYIDTV
AAKPEPVAEKEESSTSADETPAAASSTTTTPAATATVGAPFGDVGPSAATCIYEKIVSSA
STTTATGAIPGTAGGPPPAPNGSPVIPEEKLCKICYAAEYNTAFLPCGHVVACAKCASSV
TKCPLCRKPFSDVMRVYFS
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggcaaatgtattaaccaatccgaggtacatgtatggaccgactgctgcactcgagttg
acagcggttctcgaccaggtggacaacaatacgaatgctacgcagctgttcaagaacaac
atctacaacatcatgaacgagtacaatcgggaggaagcgcgcctgaaaaccttcgccaat
tggcctctggcgtggctcgacaagcatcagttggcccgaacgggcatgttctatacgaac
gataacgataaggtcaagtgctatttctgcgaggtggagatcgggcgctgggatctcgat
gatcaacctgtacctgagcacctgcgctggtcgcccaactgtccgctcctgcgccgtcgc
accaccaacaatgtgccgctgaacagcgaggccctcgaccgcatcctgccccccatcagc
tacgacatttgcggcgccaacgactcgacggtcgagcttcgcgagagcgcctatgccgag
ggccgcatacccatgtcgcacattgcccagtccatcgccacgaataccgccgtatccccg
ctgatgagctccattgccacctcgacggcggccacccaggccaacggggatgtccatccg
gagtcgtgtcggcaggtagccagcggaaattattttcccgagcaccccgagtacgctgtg
gagtcgacgcgcctgcgcagcttcgaggagtggccgcgcaacctgaagcagaagccaatg
cagctcgccgaggcgggtttcttctacacgggcgtcggcgaccgcgtccgctgcttcagc
tgcggcggtggtctcaaggactgggacgacaacgacgagccctgggagcagcacgctctc
tggctgagccagtgccgcttcgtcaaactgatgaaggggcagcgatacatcgacactgtg
gctgccaagccggagccagtcgcagagaaagaagagagcagcacaagcgcagacgagacg
ccagctgcagcttcctccactacaacgacaccagccgcgacggcgacagtcggggcccct
tttggcgatgtgggcccatcggcggccacttgcatatacgagaagatcgtgtcgagcgcc
agtaccaccacggcaacaggggccattcccggcacggctggaggtcccccaccggcgccc
aacggctcgccggtcattcccgaggagaagctctgcaagatctgttatgccgcagaatac
aacacggcgtttttaccctgcggccatgtggtggcctgcgccaagtgcgcctcgtccgtg
accaagtgcccgttatgccggaagcccttctccgatgtgatgcgtgtatatttttcttaa

DBGET integrated database retrieval system