KEGG   Drosophila persimilis: 6597583Help
Entry
6597583           CDS       T01063                                 

Definition
(RefSeq) histone deacetylase 6 isoform X2
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dpe  Drosophila persimilis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpe01009]
    6597583
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dpe03019]
    6597583
   04131 Membrane trafficking [BR:dpe04131]
    6597583
   03036 Chromosome and associated proteins [BR:dpe03036]
    6597583
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     6597583
Protein phosphatases and associated proteins [BR:dpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6597583
Messenger RNA biogenesis [BR:dpe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     6597583
Membrane trafficking [BR:dpe04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    6597583
Chromosome and associated proteins [BR:dpe03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     6597583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 6597583
NCBI-ProteinID: XP_002022770
FlyBase: FBgn0152178
UniProt: B4GVZ1
LinkDB All DBs
Position
Unknown
AA seq 1095 aa AA seqDB search
MAMKSGSNSNATAASSSSSGAIKSSSVGAELPKRSETLLEAKRRARNMLRHQGNTPAMQE
TVTDIFQTAVKSRPLVRGETALVYHQSMEQHCCRWDPKHLECPDRFNRVLDRCNELKLLD
RCLPVSARLATKQEILRLHTAQHFELLEQTSEVCDDQSMEELSSRFDSIYIHPSTFQCSL
LASGSTIDLVDSIITGKAQNGMAIIRPPGHHAMKAEFNGYCFFNNVALAAQHALDVHKLE
RILILDYDVHHGQGTQRFFYNDPRVLYFSIHRFEHGAFWPHLQESDYHAIGEGPGLGFNF
NVPLNETGMGDGDYMAIFQQLLLPVAMEYQPELIIVSAGYDAALGCPEGEMQVTPAFYAH
LLNPLLRLADSRVAVVLEGGYCLESLAEGAALTMRTLLSDPCPVLVEPLLPPKRSMSKSI
LNCIFAHRPYWRCLQLQGTYEPSELKTKDRSRDLHIVERAWVGGPPPVTVYPTRDTSVQH
LIPDAVVADNTARLHRLRLETILTVPAVRVCYAYNPEMMEHRNLDDLGHPEQPKRIQFIH
KMHEDYQLLGRMKQLSARAATTDEICLAHSRSHVNTMRRVLGRDKEDLQAQAATYNSVYL
HPATFGCATLAAGSVLQAVDSVLRGESRSAICNVRPPGHHAEPDQPHGFCIFNNVAIAAQ
YAIREFGLKRVLILDWDVHHGNGTQHIFESNPKVLYISVHRYENGTFFPKGPDGNYDVVG
KHTGAGFNVNIPWNKKGMGDLEYALAFQQIVMPIAYEFQPELVLVSAGFDAAIGDPLGGC
KVSPEGYGLFTHWLSALAGGRIVVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPLLGVVA
LTRPPTTAFQSCLETLQCCVEVQRQYWKSLEFVGYRLPHGYQIGENNNEDFLAASLLKLN
ISSDDAQGAAGGPTDGDQADPGQERPSDSKPKVKVKPPNHSTAAPEEMFAIPPSKTCPHM
RMLRPELVPQSINTRAPCGECISRSENWMCLSCHYIGCGRYVGRHMQRHCEALEHTLVMR
LQDHAVWCYVCGVYLDNPRLFEYKNRAHQDKYGRPLAWRYPCAKRADGCYPLDPESDSEE
EADHIANGSYLQEAQ
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atggctatgaagtcgggttcgaattcgaatgcgactgcggcatcgtcgtcatcgtcgggg
gcgatcaaaagcagcagcgtcggcgccgagctgcccaaacggagcgaaaccctcttggag
gcaaaacgtcgcgctcgaaacatgctcaggcaccaaggcaatacaccagccatgcaggaa
actgtgacggatatattccagacagctgtcaagtcgcggcctctggtgcgcggagaaacg
gctctggtctaccatcagtcgatggagcagcattgctgccgctgggatccaaaacatttg
gagtgtcccgatcggtttaatcgcgttttggatcgctgcaacgagctgaagctattggat
cgctgcctgccagtgtccgccaggctggccaccaaacaggagatactccggctgcatacg
gcccagcattttgaactgttggagcagacgtccgaagtgtgcgacgaccagagcatggag
gagcttagctctcgctttgattcaatatacatacatccgtccacttttcagtgctctttg
cttgccagcggatccaccattgatctggtggattccataattacgggcaaggcgcagaat
ggcatggccatcatccgaccgccagggcatcatgccatgaaggccgaattcaatggctat
tgtttcttcaacaatgtggccttggccgctcagcatgccctcgacgtgcacaagctggag
cgcatcctgatccttgactacgatgtccatcatggtcagggcacacagcgcttcttctac
aacgatcccagggtgctgtatttctctatacatcgcttcgagcacggcgccttctggcca
catctgcaggagtccgactaccatgccattggcgagggccctggcctgggcttcaacttc
aatgtgccgctcaatgagacaggaatgggcgacggggactacatggccatcttccagcag
ctgctactgcccgtggcaatggagtaccagccagaactgatcatcgtctcggccggctat
gatgcggccctgggctgtcccgagggtgaaatgcaggtgacgcccgccttctatgcgcat
ctgctcaatccgctgctccgactggccgactcccgtgtggccgtcgtgctcgaaggaggc
tactgccttgaatctctggccgagggagcggccctcacgatgcgcaccctgctgagtgat
ccctgccccgtgctggtcgagccgctgctcccgccgaagcgttcgatgtccaaatccatt
ctcaactgcatatttgctcaccggccgtactggcgttgcctgcagctgcagggcacctac
gagccatcagagctgaagaccaaggatcggagtcgggacttgcatatagtggaacgtgca
tgggttggcggaccgccacccgttaccgtttatccgacgcgggacacctccgtgcaacac
ctcattcccgatgcggtagtggcggataacacggcccgattgcaccgactgcggctggag
accattctgacggttcctgcagttcgtgtgtgctacgcttacaatcccgagatgatggaa
caccgcaacctggacgacctgggccatccggaacagccgaagcgcatccagttcatacac
aaaatgcacgaggattatcagctgctcggccgcatgaagcagctgtctgcgcgggcggcc
accaccgacgagatctgtctggcgcacagtcgctcccacgtaaacacaatgcggcgagtg
ctgggccgagacaaagaggatctccaggcgcaggcagcgacctacaattcggtgtacttg
catccggccacgtttggttgcgccaccctggccgctggatccgttctccaggcggtagac
agtgtgctccgcggggagtcccgcagtgcgatctgcaatgtccgtccgcctggccatcat
gcggagccggaccagccgcacggtttctgcatcttcaacaatgttgccattgccgcccag
tacgcgatccgggagtttggcctgaagcgagtgctaatcctcgactgggatgtccaccac
ggcaatggcacccagcacattttcgagtcaaatccgaaggtactgtacatcagcgtccac
cgctacgagaacggaacattcttccccaagggccccgacggcaactacgatgtggtgggc
aagcatacgggagccggctttaatgtcaatataccatggaataagaagggcatgggggat
ctggagtacgctttggccttccagcagatcgtaatgccaattgcgtacgagttccagccg
gaactggtgctcgtgtcggcgggcttcgatgcggccatcggggatcctctagggggctgc
aaagtctcgcccgagggctacggtctgttcacccactggctgtctgccctggccggtggc
cggatagttgtgtgcctcgaaggcggctacaatgtcaactccatttcgtatgcgatgacc
atgtgcacaaagacgctgttgggggatccggtgccgacgccactgctgggggtggttgcc
ctgacaaggccgccgacaacggccttccagagctgcctggagacgctacagtgctgcgtg
gaggtgcagcgtcagtattggaagtcgctggagtttgttggctaccggctgccgcatggc
taccagattggggagaacaacaacgaggattttcttgccgcttccttgctgaagttgaat
atttcaagtgacgatgcccagggcgcggcgggcggtcccaccgacggcgatcaggccgat
ccagggcaggaacggcccagcgatagcaagcccaaagtcaaggtaaagccgcccaatcat
tcaaccgccgcgccagaggagatgtttgccattcccccgagcaagacttgtccgcacatg
agaatgctacgaccggagctggtgccgcaatcaataaacacgagggcgccgtgcggcgag
tgcatctctaggtcggagaactggatgtgtttgagctgtcattatattggctgtgggcgc
tacgtgggccggcacatgcagaggcactgcgaggctctcgaacatacactggtgatgcgc
ttgcaggaccatgccgtgtggtgctatgtgtgcggcgtttacctcgataatccgcgactc
ttcgaatacaagaatcgggcgcatcaggacaaatacggcagaccgctggcctggcgctat
ccctgtgcgaagcgtgccgatggctgttatccgttggatcccgaatcggattcggaggag
gaggccgatcatattgccaatgggagctatctccaggaggcccagtga

DBGET integrated database retrieval system