KEGG   Drosophila persimilis: 6598528
Entry
6598528           CDS       T01063                                 

Definition
(RefSeq) septin-5 isoform X1
  KO
K16943  septin 4
Organism
dpe  Drosophila persimilis
Pathway
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    6598528
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpe04131]
    6598528
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dpe04812]
    6598528
Membrane trafficking [BR:dpe04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    6598528
Cytoskeleton proteins [BR:dpe04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     6598528
SSDB
Motif
Pfam: Septin RsgA_GTPase MMR_HSR1 GTP_EFTU Ras AIG1 AAA_22 Roc AAA_16 AAA_7 VirE ABC_tran AAA_29 IIGP FeoB_N
Other DBs
NCBI-GeneID: 6598528
NCBI-ProteinID: XP_026846308
LinkDB
Position
Unknown
AA seq 465 aa
MKHQPPPPPLPLTQPPSLSGGGVGGVSGSSSGSSSIVANAISSLNGNNSATSSSSCIQPA
NNNNNNHNNNISSSRGSSFEAGKCRPPLYPKPKTPSFDKDRDYIGFATLPEQVHRKSVKR
GFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTRVEKKTMDIEERGVR
LRLTVVDTPGFGDAINCEDSWRVCTSYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVP
PWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFP
ECDSDEDDDFKQQDRELKASIPFAVVGSNTILEVAGKKVRGRQYPWGVVNVEDPEHSDFI
KLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRDSISSTNGFDAAI
SETDRLLLQKDEEIRRMQDMLTQMQEKLKQTHLMEMKKNDSVIDV
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaaacaccagccgccgcctcctccgctgcccttaacgcagcccccatcgctgagtggc
ggcggggttggtggggtctctggcagcagcagtggaagcagcagcatagtggccaatgcc
attagcagcctcaatggcaacaacagtgccaccagcagcagcagttgcattcaaccagcc
aacaacaacaacaacaatcacaacaacaacatcagcagcagccgtggcagcagctttgag
gcaggaaaatgtcgcccacccctctacccaaaacccaagacaccctcgtttgacaaggac
cgtgactacattgggtttgccacgctgccggagcaggtgcaccggaagtcggtgaagcgt
ggcttcgagttcacgctgatggtggtcggggagtccggcctgggcaagtcgacgctcatc
aacagcctcttcctcggtgacctgtacaagaaccgccagatgcccaacgtggaggagcgc
atcgagaagacgacccgcgtcgaaaagaagaccatggacatcgaggagcgcggcgtccgg
ctgcgcctcactgtggtggacacgcccggtttcggggatgccatcaactgcgaggacagc
tggcgggtgtgcacctcgtacatcgacgagcagttccgccagtacttcaccgacgagagc
ggactgaatcggcgcaacatacaggacaaccgagtgcactgctgcctctactttgttccg
ccctgggggcacagcctgcgacagatggatctggacctgatcaggcggctgcatcgcaag
gtgaacattgtgctggtgattggcaaggcggactgcctgaacaagcaggaggtgcgcaag
ctcaaggagcgcatactgcaggacctcgaggacaatcacatacagctgtaccagttcccc
gaatgcgactccgacgaggacgatgacttcaagcagcaggaccgcgagctgaaggcctcc
attccgttcgccgtcgttggcagcaacaccattctggaggtcgccggcaagaaggtgcgc
ggccgccagtatccctggggtgtggtcaatgtggaggatccggagcacagcgacttcatc
aagctgcgcaccttcttgatatccacgcacatgcaggacttgaaggacaccacacaggat
gtgcactacgagaacttccgggcgcagtgcatctcacagatctcgcagcatgcgctgcgg
gagcgcggcaagttgaagcgcgactcgatcagctcgacgaacggattcgatgcggccatt
tcggagacggacaggctgctgctgcaaaaggacgaggagatcagacgcatgcaggacatg
ctcacccagatgcaggagaagctcaagcaaacgcatctcatggagatgaagaagaacgac
agcgtgatcgatgtctag

DBGET integrated database retrieval system