KEGG   Drosophila persimilis: 6598945
Entry
6598945           CDS       T01063                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
dpe  Drosophila persimilis
Pathway
dpe04013  MAPK signaling pathway - fly
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    6598945
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6598945
   04215 Apoptosis - multiple species
    6598945
SSDB
Motif
Pfam: Zip DUF3915
Other DBs
NCBI-GeneID: 6598945
NCBI-ProteinID: XP_002024132
FlyBase: FBgn0160308
UniProt: B4GZV3
LinkDB
Position
Unknown
AA seq 403 aa
MAVPFYLPEGGADDIASSGASGSSSGASSSGASTSSAGSSDGASSIASQSPNTTTSATQT
PMQSPLPTEQVLYALCQWVRHYHSQTQQNAAQIFQYPPPPSPSCNYTVGDVFFPHGPPPV
PPRTPRTSVSFAAGEEYNFFRQQTQPPYPAPSTPQPMPPQPPQSAPPMHYSHSFPQQSPH
LLQHHHPASVYGMGQHQPGPGSYYATYTPPPTPNTANAGTSTSSAAFGWHSHGPQLASTP
LTAPMGSKMRLQRSQSDAARRKRLTSTGEDEREYQSDHETSWDDEYDDRYDNFTAGRERL
QEFNGRIPPRKKKNSHSSSSSHSHSHSNNNPISQNNFQLHSSNAECSSSASGSASHGSNS
QREREREREQRAEAEKKKPQVFTWPTVVTVFVLAMGCGFFAAR
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggccgtgcccttttatctgcccgagggcggagccgatgacatcgcctcgtcgggcgcc
tcgggctcctcttcgggcgcatcctcgtcgggtgcctccacctcgtcggcaggttcctcg
gacggcgccagcagcattgcctcccagtcccccaacaccaccacatcggccacgcagacg
ccgatgcagtccccactgcccacggagcaggtgctctacgccctctgccagtgggtgcgc
cactatcacagccaaacccaacagaacgccgcgcagatcttccagtacccgccgccgccg
agtccctcatgcaactatacggtcggcgatgtcttcttcccccacggcccaccgccagtg
ccgccgcggacaccgcgcaccagcgtcagctttgccgccggcgaggagtacaacttcttc
cggcagcagacacagccgccgtatccggcgccgtccacgccgcagccaatgccaccgcag
ccgccgcagtcggcgccaccgatgcactacagccacagcttcccgcagcagtcgccgcac
ttgctgcagcaccaccatcccgcctccgtctatggcatggggcagcaccagccgggtccc
ggctcctactacgccacctacacaccgccccccacaccgaacacggccaatgccggcacc
tcgacctcatcggcggcctttgggtggcacagccatggcccccagctggcatcgacaccg
ctgacggcgccaatgggctccaagatgcggctgcagcgcagccagtcggatgcagccaga
cgcaagcgattgacctcgacgggcgaggatgagcgcgagtatcagagcgatcatgagacc
agctgggatgatgagtacgatgatcgttatgacaattttacggccggacgggagcgtctg
caggagttcaacggacggataccaccacggaagaagaagaacagtcacagcagcagcagc
agccacagccacagccacagcaacaacaatccaatcagccaaaataatttccaactccat
tcatcgaatgccgagtgcagcagcagcgccagcggcagtgccagccacggcagcaacagt
cagagagagcgagagcgggagcgcgagcagcgagcggaggccgagaagaagaaaccgcag
gtcttcacctggccgaccgttgtgaccgtgttcgtgctggccatgggatgtggcttcttt
gcggcgcgatga

DBGET integrated database retrieval system