KEGG   Drosophila persimilis: 6599000Help
Entry
6599000           CDS       T01063                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dpe  Drosophila persimilis
Pathway
dpe04146  Peroxisome
dpe04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    6599000
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    6599000
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     6599000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 6599000
NCBI-ProteinID: XP_002024068
FlyBase: FBgn0016296
UniProt: B4GZN9
LinkDB All DBs
Position
Unknown
AA seq 152 aa AA seqDB search
MVKAVCVINGDAKGTVFFEQETSEAPVKVTGEVLGLAKGLHGFHVHEFGDNTNGCMSSGP
HFNPRNKEHGAPTDENRHLGDLGNIQAAGDSPTAVSITDSKITLFGADSIIGRTVVVHAD
ADDLGKGGHELSKTTGNAGARIGCGVIGIAKI
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagctgtctgtgtaattaatggcgatgccaagggcaccgttttctttgagcag
gagaccagcgaggctcccgtgaaagtcaccggcgaggtgctgggccttgccaagggactg
cacggattccatgtgcacgagttcggggacaacaccaacggctgcatgtcgtccggcccc
cactttaacccccggaacaaggagcacggtgcccccaccgacgagaaccgccacttgggc
gacttgggcaacatccaggcggccggtgacagccccacggccgtcagcatcaccgactcg
aagatcacgctgttcggtgccgacagcatcataggacgcaccgtggtcgttcacgccgac
gctgatgacttgggcaagggtggtcacgagctaagcaagaccaccggcaatgccggcgcc
cgtattggctgcggtgtcattggaattgccaaaatctaa

DBGET integrated database retrieval system