KEGG   Drosophila persimilis: 6599022
Entry
6599022           CDS       T01063                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6599022
   04215 Apoptosis - multiple species
    6599022
SSDB
Other DBs
NCBI-GeneID: 6599022
NCBI-ProteinID: XP_002024139
UniProt: B4GZW0
LinkDB
Position
Unknown
AA seq 144 aa
MAIAYFIPDQAQLLARSNQQSAQQAAASTGAVPQQPGQQAGQQQAGQQAEQPQTSQQRQQ
RPQFRANISVPLGRQQGAMSMSEFGCWDLLAQIFCYALRIYSYNSSQRRPTVIQISFEIR
SGGQEEQQQEEHQADATDATGKGN
NT seq 435 nt   +upstreamnt  +downstreamnt
atggccattgcatatttcatacccgaccaggcccaactgctggccagaagcaatcagcaa
agtgctcaacaggccgccgcctcaacaggagccgtgccccagcagccaggacaacaggca
ggacaacagcaggcaggacaacaggcagagcagccgcagacgagtcagcagcgacagcaa
cgtccccagttccgtgccaacatatccgtgcctctgggccggcagcagggagccatgagc
atgtccgagttcggctgctgggaccttctggcccagatcttctgctatgccctcagaatc
tacagctacaactccagccagcgccggcccacggtcattcagatctccttcgagatcagg
agtggcggccaggaggagcagcagcaggaggagcaccaggcggatgcgactgatgccaca
ggcaagggcaactga

DBGET integrated database retrieval system