KEGG   Drosophila persimilis: 6599027
Entry
6599027           CDS       T01063                                 

Definition
(RefSeq) cell death protein rpr
  KO
K20014  cell death protein rpr
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6599027
   04215 Apoptosis - multiple species
    6599027
SSDB
Other DBs
NCBI-GeneID: 6599027
NCBI-ProteinID: XP_002024144
FlyBase: FBgn0160299
UniProt: B4GZW5
LinkDB
Position
Unknown
AA seq 72 aa
MAVAFYIPDQATLLRKAAQQEQELLRLRDSQWRFLATVVLETLRQFMDSAASQCLPRSGG
GRKCGKYRKPSQ
NT seq 219 nt   +upstreamnt  +downstreamnt
atggcagtggccttctacatacccgaccaggcgactctgctgcgcaaggcggcgcaacag
gagcaggagctgctgcgcctacgcgactcccagtggcgcttcctggccaccgtcgtcctc
gagaccctacgccagttcatggacagcgcggccagccagtgcctgccacggtccggtggc
ggccgcaagtgcggcaagtaccgcaagccctcgcagtaa

DBGET integrated database retrieval system