KEGG   Drosophila persimilis: 6599948
Entry
6599948           CDS       T01063                                 

Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
dpe04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6599948
   04215 Apoptosis - multiple species
    6599948
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    6599948
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6599948
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     6599948
Peptidases and inhibitors [BR:dpe01002]
 Cysteine peptidases
  Family C14: caspase family
   6599948
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 6599948
NCBI-ProteinID: XP_026849158
LinkDB
Position
Unknown
AA seq 511 aa
MSGHNILTQLESIDVLDLPYVERDLNSAQLVSLSFLLYGDEHSTATYILQKLLVLTRAAA
SDWPPTDILSQYAKSKPQTWRKYLVEALCIIGARQVLRKLGLCWQELRMHYLPHVGSIRV
HIHPLLKSLYTICEELSLAQRGRMVLDIKEKNSVGDPLRFYDPEYLEIFLLDWLTRRLIR
LGDINANGSDVQLLIEYFKFNDLHAQATLLVDTVNAYATSSCSPATPNVLLPMDGNGIAN
ESSTPTAAASRPRAKNALQLSRENAGIALIINQQKFYRDGSDDHKVYLPPIELPPRNGTD
MDKQRLTNVFSKLGYRVEAHDNLDHLSMLHHIRQACQRSLLHESLVLCILSHGFEDAVYG
SNSVALRISDIENVLCSYKNLYEKPKLVVIQACQQEDKENNSLPYKIDASTKSPFQYLNM
LRAMSTVPGFPALRHTQTGSWFIQCLCDAIVEHSNSDHIADILTIVINNVANKRGNKNET
MVPWTGGALRQHVYFPRTSATDKVVPDSPGR
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgagcggccacaatatcttgacgcaattggagagtatcgatgtcctcgatctgccttat
gtggagcgcgatctgaactctgctcaactggtgagcctgtccttcctgctgtatggcgac
gagcattccactgccacgtatattttgcaaaagctcctggtgttgacccgcgccgctgcc
tccgactggccgcccaccgacatcttgagccagtatgccaaatccaagccccaaacctgg
cgcaaatatctcgtggaggctctgtgtatcatcggggcgcggcaggtgctgcgcaaactc
ggactctgctggcaggagctgcgcatgcactacctaccccacgttggcagcatccgtgtg
catatccatccgctgttaaagagcctgtacacgatctgtgaggagttgtcgctggctcag
aggggtcgaatggtgcttgatatcaaggagaagaacagcgtcggggatccgctgcgcttc
tatgaccctgaatatctggagatctttttacttgactggctgacgcgacgtctgatacgg
ctgggcgacatcaatgccaacggcagtgatgttcagctgctaatcgaatacttcaagttc
aacgatctgcatgcccaggccacgctgctcgtcgatacggtcaacgcttatgccacctcc
agctgctcccctgcaacaccgaatgtgctgcttccaatggacggcaatggcattgccaac
gaaagctccacccctacggcggctgcgtcccggccccgggccaagaatgcacttcagctg
agtcgcgagaatgctggcattgcgctgataatcaaccagcagaagttttaccgggatggc
agcgatgatcacaaggtctacttgccgccaattgagttgccgccacgcaatggcaccgat
atggacaagcagcggctaactaatgtcttctccaagcttggctacagggttgaggcccac
gataatctcgaccatctgtcaatgctccatcatatacggcaggcctgtcagcggtccctg
ctgcacgagtctctggtgttgtgtattctgtcgcacggctttgaggatgctgtctatggc
tctaatagcgttgctttgcgcatatcggatatcgagaatgtactctgtagctataaaaat
ctgtacgaaaaaccaaagcttgtcgtcatccaggcgtgtcagcaggaggacaaggaaaac
aattccctgccgtacaagatcgatgccagcacaaagtcacccttccagtacttgaatatg
ctgcgagccatgtccactgtgcccggttttccagcgctgcgacacacccagacaggcagc
tggtttattcaatgtctgtgcgatgccattgtcgagcattcgaatagcgatcatattgct
gacattctgacgattgtcatcaataatgtggccaacaaacggggcaacaaaaacgagacc
atggtaccctggaccggcggcgcgctacgacagcacgtttactttccgcgcaccagcgcc
actgacaaggtggttccagatagccccggtcggtag

DBGET integrated database retrieval system