KEGG   Drosophila persimilis: 6600243
Entry
6600243           CDS       T01063                                 

Definition
(RefSeq) caspase Dronc
  KO
K20009  caspase Dronc [EC:3.4.22.-]
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6600243
   04215 Apoptosis - multiple species
    6600243
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpe01002]
    6600243
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     6600243
Peptidases and inhibitors [BR:dpe01002]
 Cysteine peptidases
  Family C14: caspase family
   6600243
SSDB
Motif
Pfam: Peptidase_C14 CARD Death
Other DBs
NCBI-GeneID: 6600243
NCBI-ProteinID: XP_002025408
FlyBase: FBgn0150169
UniProt: B4H3H9
LinkDB
Position
Unknown
AA seq 457 aa
MQHSRREIGMLQKHRDHINEHLDELVKCTNYTRIREECVRINLLSPDMLRNVEDLSGAGF
NMSKEDSQLEQHRRLLIKITKRGPAAYNQLITVLRNVGSLQAVKLLEDVSEQNSGSPFIS
INERKITRKSADIVDTPSPSPTATADRNGACVSKREYNEAGGPLIPYTEPVDGQKRDVKK
SDRVHTDEVVGTYNMQSQHYRGVLLMINIIDFPDTERKRNGAEVDSDSLIHLFREMGFTI
FAYNNMNQEQFFDTLGKVTSSKYAQQTECFVMVLMTHGERVGEMDKVEFGDGSVVDVHKI
KNYFQASVSPYLVHKPKVLIFPFCRGREADLGQRINHFDSIGTAASRLSRQEETVVETEG
RPSTYTNVPSLSDTLVCYASTPGYVTHRDAESGSWYIQTFCDMMADHAHNTPVEDILKKT
NELVGHMRTSKGSMQTGSFDNLGFNKKLYFNPGFYTE
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcagcattcgaggcgagaaatcggaatgctccaaaagcatcgcgatcacatcaacgag
cacctcgatgagctggtgaaatgcaccaactacacgcgcatcagggaggagtgtgttcga
ataaacctgttgtcgcccgacatgctgcgcaatgtcgaagacctcagcggcgcaggtttt
aacatgagcaaggaggacagccagctggagcagcacaggcggctcctaatcaagataacc
aagcgtggtccagcggcctacaaccagctcattactgtcctgcgcaatgtggggagtctt
caggcggtgaagctgctggaggatgtttccgagcagaattccggctcccccttcatatcc
atcaacgagaggaagatcacccgcaagtcggccgacatagtggataccccgtcgccatcg
ccgacggcgacggcggacagaaatggtgcatgtgtcagcaagagagaatacaatgaagca
ggtggaccgctaatcccctacacggagcccgttgacggacaaaagcgtgacgtcaagaag
tcggacagagtccacactgacgaagtggttggcacgtacaacatgcagtcgcagcattat
cggggcgtgctgttgatgatcaatatcatagactttccggatactgagcgcaagaggaac
ggggccgaagtagacagcgattcgctgatccacctgttcagggaaatgggcttcacgata
ttcgcctacaacaacatgaaccaggagcagttcttcgacacactcggcaaggtcacttcg
tcgaagtacgcacagcagaccgagtgctttgtaatggtgctgatgacgcacggcgagcgt
gtcggggaaatggataaagtggagtttggcgacggctcggtggtggatgtccacaagatc
aagaactatttccaggccagtgtgagcccgtacttggtgcacaagccaaaggtgttgatc
tttcccttttgtcggggcagagaagccgatctggggcagcgcattaaccactttgactcc
ataggcactgcggcttcccggctgagtcgtcaggaggagactgttgttgagaccgagggc
agaccctccacctataccaatgtcccatccctgtcagacactctggtctgctatgccagc
accccgggttatgtgacccatcgtgacgccgagtcgggcagctggtacatccagacgttc
tgcgacatgatggccgaccacgcccataacacgcccgtggaggatatactgaagaagacc
aacgagctggtgggccacatgaggaccagcaagggctccatgcagacgggctccttcgat
aatctcggctttaataagaaactctacttcaatcctggcttctacacggaatag

DBGET integrated database retrieval system