KEGG   Drosophila persimilis: 6600918
Entry
6600918           CDS       T01063                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein isoform X4
  KO
K20017  Bcl-2 family protein
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6600918
   04215 Apoptosis - multiple species
    6600918
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 6600918
NCBI-ProteinID: XP_002026046
UniProt: B4H5B7
LinkDB
Position
Unknown
AA seq 290 aa
MRSTSSDNHGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGQRETTRRRLSNVSDV
VTRKLSYTIGWKAAQIPAQDIITQGRCLCGHYIKRRLRRSGLFNKKLGLQRIRSILGSTS
MGIVRDVFPAVQVLGDELERMHPRAYNGVARQICRNPGGEFHTPDAVSLLLGAVGRDLFR
ADITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINENGGWSGIN
THVLPTTNSLNPLEWTTLVIGVVFGLILLFMFLRFIVSTIIPKIYQRFTN
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcgatccacttccagcgataaccacggcttccccatggccaccacacagagcgaacgc
ctgctgcaggcccagaatcggcgcaagttcagcttcccggccacgctccactccgcctcg
ctgctggaggtggggcaacgcgagacgacccggcggcgcctcagcaatgtcagcgacgtt
gtcaccaggaaactctcctacaccattggctggaaggcggcacagattcccgcccaggac
atcataacgcagggccgctgtctgtgcgggcactacatcaagcgacgcctgagacgatct
ggtttgttcaacaagaagttgggcctgcagcgaatacggagtatcctgggctccacctcc
atgggcattgtgcgggatgtctttccagcggttcaggtgcttggcgacgaactggaacgg
atgcatccccgtgcctataacggcgtcgcccgtcagatttgtcgcaatcctgggggcgag
ttccacacacccgatgctgtcagcctgctcctaggggcggtgggtcgggatctgttccgg
gcggacatcacctggagcaaggtgatctcgctgtttgccattgccggcggcctgtcggtg
gactgtgtgcggcaggggcatcccgagtacctgcccaagctgatggagagcgtctcggag
gtgattgaggatgagctggtgccctggatcaatgagaacggtggctggagcggcatcaat
acccatgtcctgcccacgacgaacagcttgaatccgctcgagtggacgacgctggtgata
ggtgtggtttttggcctaattctgctttttatgttcttacgttttatagtaagcacgata
ataccgaaaatatatcaacgatttacgaactga

DBGET integrated database retrieval system