KEGG   Drosophila persimilis: 6601295
Entry
6601295           CDS       T01063                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B isoform X1
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
dpe  Drosophila persimilis
Pathway
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6601295
   04215 Apoptosis - multiple species
    6601295
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 6601295
NCBI-ProteinID: XP_002026333
UniProt: B4H654
LinkDB
Position
Unknown
AA seq 302 aa
MPSTMAPTTSPTAPKLAKFKSSSLDLEIYSANRRGTIATAASDWKALRSSPSNGRSLHAG
GGHGLGLGPGLSSMTRAASTSSLASSTRTMTNYQEYKMEIINQGKCLCGQYIRARLRRAG
VLNRKVTQRLRNILEPSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELED
GDMAPMLLNLVAKDLFRSSITWGKIISIFSVCGGFAIDCVRQGHYDYLQCLVDGLAEIIE
DDLVYWLIDNGGWLGLQQHIRPRVGEFTFLGWLTLFVTISAGAYMVSNVCKRIGCQLYSL
LF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgccatcgaccatggcccccactaccagtccaaccgccccgaagctggccaagttcaag
tcctcatccctggacctggagatctactcggcgaatcgacgcggcacgattgccacggcg
gccagtgactggaaggcactgcgcagcagcccttccaacggacgatctcttcatgccggg
ggcgggcacggtctcggactcggaccaggcctctcctcgatgacccgggccgcatccaca
tcatcactagccagcagcacacgcaccatgaccaactatcaggagtacaaaatggaaatt
attaatcagggcaagtgtctctgtggtcagtatatcagagcgcggctacgacgcgccggc
gtcctcaatcggaaggtgacacaaagactgcgaaacatactggaaccctcttcccatgtg
gtctacgaagtgtttcctgccctcaatagcatgggcgaggaactggagcgaatgcacccg
cgtgtctacacaaacatatccaggcagttatcgagagctccgtttggtgagctagaggac
ggtgatatggcccccatgctgctcaatttggtggccaaggatctcttccggtcgagcatt
acctggggcaagatcatctcaatattttcggtctgtggcggctttgccatcgactgtgtg
cgccagggccactacgactacttgcaatgccttgtggatggcctggccgagataattgag
gacgatctggtgtactggctgatagacaatggcggatggctcggactgcagcagcacata
cgtcctcgcgtgggggaattcacatttctgggctggctgacactgtttgtgactatttcg
gcgggagcctatatggtatctaatgtatgcaaacgcattggctgtcaattgtattctttg
ttgttttag

DBGET integrated database retrieval system