KEGG   Drosophila persimilis: 6601435Help
Entry
6601435           CDS       T01063                                 

Definition
(RefSeq) pyrimidodiazepine synthase
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dpe  Drosophila persimilis
Pathway
dpe00480  Glutathione metabolism
dpe00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6601435
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    6601435
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     6601435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 6601435
NCBI-ProteinID: XP_002026471
FlyBase: FBgn0153108
UniProt: B4H6J2
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MSNGRHLAKGSPIPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTEKPDW
LFDKNPQGKVPALELVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQERLLIER
FNSVLGAFFRASDGGDLEPFWCGLDTYEKELSRRCTDFFGGEQTGILDYMIWPWCERLDL
LKVQRGDDYNFDERRFPQLSQWVERMKRDSAVMAFYMEAEVQAEFLRTRSAGRPNYNLLV
KEA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacggcagacacttggctaaaggctctcccattccggatgtgcccgaggatggg
atactgcggttgtactccatgcgcttctgtccgttcgcccagcgtgtccatctagtgctg
gatgccaaacagataccctaccacagcatttacataaatctcacagagaaaccagactgg
ctattcgacaagaatccgcagggcaaggtgccagcactggagctggtgcgcgaaccgggt
ccaccggtgctgaccgaatcgctgctcatctgcgagtacctggacgagcagtatccactg
cgaccgctttatccgcgagatccactgaagaaggtccaggagaggcttttaatcgagcgc
ttcaactcggtcctgggcgccttctttagggcatctgatggcggcgacctggagccattc
tggtgtggcttggatacctatgagaaggagctaagccgccgttgcactgacttctttggt
ggcgaacaaacgggtattctcgactacatgatatggccgtggtgtgagcgcctggacttg
ctcaaggtgcagcgaggcgatgactacaatttcgatgagcggcgcttcccgcagctgtcg
caatgggtggaacgcatgaagcgggattcggctgtgatggccttctacatggaggcggaa
gtgcaagcagagttcctgcgcactcgcagcgccggcagacccaactataatctgctggtc
aaggaagcatga

DBGET integrated database retrieval system