KEGG   Drosophila persimilis: 6601737
Entry
6601737           CDS       T01063                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
dpe  Drosophila persimilis
Pathway
dpe04013  MAPK signaling pathway - fly
dpe04214  Apoptosis - fly
dpe04215  Apoptosis - multiple species
dpe04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    6601737
   04391 Hippo signaling pathway - fly
    6601737
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6601737
   04215 Apoptosis - multiple species
    6601737
SSDB
Motif
Pfam: TNFR_c6 Comm PhoR
Other DBs
NCBI-GeneID: 6601737
NCBI-ProteinID: XP_002026795
UniProt: B4H7G6
LinkDB
Position
Unknown
AA seq 371 aa
MMPPRLPHSSGVAAAAATKRVTTSRSISSHNNHFIHSRSTTNTTFHKRRRRRHDISNATD
ATSDATVAPAPARCSITRRAPAIICLALLLLSTTCSLRTVAASSASSTSSSSAATTSASA
SGSGSASEIASSSPCAPQHWWDPLRDKCTACTVCLGEMIPLRPCQLHTNTICGSIYDLKI
DWVVLAKTEPNWKERRKSSEYEHFEQDAPLQHLTHEQLQQLHEEAAAAWVLDWQTGVLYV
AVLTCLIFFSVAACILIHHMRQWRRMERRLDQDVEELSTKLMAKLAEVQSLDGGTFFIGN
ADALRGLPAAAASHAASAAQSGIFQPQHVLLPEKHQGKHQERRILKTLQPGNVYIEENNG
GMMGIGASSKG
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgatgccgccaagactgccccatagctctggagtagcggcagcagcagcaacgaaacga
gtaaccacgagtagaagtattagcagccacaacaaccactttatccatagccgaagcacc
accaatacaacatttcacaagcgccgacgtaggcgacacgacatcagcaacgccacagat
gcaacatcagatgccactgtagcacctgcccctgccaggtgcagcatcacgaggagagcg
cctgccatcatctgtttagcgctacttcttctctccaccacctgctccctgaggactgtt
gcggcttcatctgcatcttctacatcatcatcatctgcagctactacatctgcgtccgct
tcaggatctggatcagcatcagaaatcgcctccagctccccctgcgccccacagcactgg
tgggacccgttgcgggacaagtgcaccgcctgcaccgtctgcctgggcgagatgatcccg
ctccggccctgccaactgcacacgaacaccatctgcggctccatctacgacttgaaaatc
gattgggtcgtcctcgccaagacggagcccaattggaaggagcgccgaaagtcttcagag
tatgagcacttcgaacaggatgccccgctgcagcatttgacccacgagcaactgcagcag
ctgcacgaggaggcggccgctgcctgggttctcgactggcagacgggcgtcctctatgtg
gccgtcctcacctgcctcatcttcttctcggtggccgcctgcatcctcatccaccacatg
cgccagtggcgacgcatggagcggcgcttggatcaagacgtggaggagctgtcgacgaag
ttgatggccaagctggcggaggtgcagagcctggacggaggaacctttttcattggcaac
gctgacgccttgcgtggattgcccgctgccgccgcctcgcatgcggcctcggcggcgcag
tcggggatcttccagccgcaacatgtgcttctgcctgagaaacatcagggtaagcatcag
gagcgacggattctgaagaccctgcagcccggtaatgtctacatcgaggagaacaatggg
ggcatgatgggaataggtgccagctccaagggttga

DBGET integrated database retrieval system