Drosophila persimilis: 6602822 Help Entry 6602822           CDS       T01063                                  Name (RefSeq) probable insulin-like peptide 3   KO K04526   insulin Organism dpe  Drosophila persimilis Pathway dpe04068   FoxO signaling pathway dpe04140   Autophagy - animal dpe04150   mTOR signaling pathway dpe04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:dpe00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     6602822    04150 mTOR signaling pathway     6602822  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6602822  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     6602822  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dpe04052]     6602822 Cytokines and neuropeptides [BR:dpe04052]  Neuropeptides   Neuropeptides (Unclassified)    6602822 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  6602822 NCBI-ProteinID:  XP_002027824 FlyBase:  FBgn0153930 UniProt:  B4HAE5 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MQQTKSKSLYLVLILVGLVVMGQQTAADMYLCGTELNDALSTMCGRHGYNRMLKRSFDPT DYNDIEGGFGLARMEFDDRSLLHRMLGESAAQLMKTRRRRVGVSDECCLKPCSLGELLNY CAKPPGQYGN NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgcagcagaccaagtcgaagagcttatacctcgtcctaattcttgtggggctggtggtg atgggacagcagaccgcagcagacatgtatctttgcggcaccgaactgaacgatgccctg tccaccatgtgtggccgccatggctataaccggatgctgaagcggtctttcgatccgacg gactacaatgatatcgagggtggattcggattggccagaatggaatttgatgatcgctcg cttctccatcgaatgctgggcgagagcgccgctcagctgatgaagacacggcgtcgtcgt gtcggggtctccgacgaatgctgcctgaagccgtgctcacttggagagctcctcaactac tgtgccaagccgcctgggcagtatgggaactaa

DBGET integrated database retrieval system