KEGG   Drosophila persimilis: 6603117Help
Entry
6603117           CDS       T01063                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
dpe  Drosophila persimilis
Pathway
dpe00020  Citrate cycle (TCA cycle)
dpe00190  Oxidative phosphorylation
dpe01100  Metabolic pathways
dpe01200  Carbon metabolism
Module
dpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpe_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6603117
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6603117
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     6603117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2
Motif
Other DBs
NCBI-GeneID: 6603117
NCBI-ProteinID: XP_002028083
FlyBase: FBgn0158924
UniProt: B4HB54
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MFLVRRPTHLLKFRSKIQLVRSIVCPEPSIRVSDDEQEYVKAGQAILTKGQTPPPPPLPP
QPLPPTMVPSTEDPITVATAAAGGDKKPPPKGPAPPKEPPKLPPAVAEKKKVAGPPAPPK
TKEKRIKNFEIYRWQPGEQPKMQTYAIDLSQCGAMVLDALIKIKNEVDQTLTFRRSCREG
ICGSCAMNIDGTNTLACVTPIDQSTSGSCRIYPLPHLYVVRDLVPDLSQFYEQYRSIQPW
LQRNNIQNEMGKAQYLQSLEDRNKLDGLYECILCACCQTSCPSYWWNSDKYLGPAVLMQA
FRWVIDSRDEATEQRLCFLQDPWKLYRCHTILNCTNTCPKNLNPARAIIQLKQLLSGAKK
KNKPELQTDALFTGK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagtgcgcagaccgacacatttgctgaaatttcggtcaaaaattcaattggtg
cggtccattgtttgccccgagccatcgattcgggtgtcggacgatgagcaggagtatgtg
aaggccgggcaggcgattctcaccaaaggtcagacaccaccaccgccgccgttaccgccg
cagccgctaccaccgaccatggtaccgtcaactgaagaccccattacggtggcaacagca
gcggccggaggcgataaaaagccaccacccaaggggccagctccaccgaaggagccccca
aagctgccaccagccgtggcagagaagaagaaggtggccggaccaccggcaccgcccaag
accaaggagaaacgtatcaagaactttgagatctaccgctggcagcccggggagcagccc
aagatgcagacgtacgccatcgatttgtcgcagtgcggcgccatggtgctggatgctttg
atcaagatcaagaacgaggtcgaccagacgttgaccttccgccgatcctgccgtgagggc
atctgtggctcgtgcgccatgaacatcgatggcacaaacaccctggcctgtgtcacgcca
atcgaccagagcacgagtggatcgtgccggatctatccgctgccgcatctgtatgtggtg
cgcgatctggtgccggacctgagtcagttctacgagcagtaccgctccatccagccctgg
ctgcagcgcaataacatccagaacgagatgggcaaggcgcagtatctgcagtccctggag
gaccgcaacaaactggatggcctgtacgagtgcatcctgtgcgcctgctgtcagacctcg
tgcccatcctattggtggaatagtgacaagtatctggggccggccgtcctcatgcaggcc
tttcgctgggtcatcgattcccgtgacgaggccaccgagcagcggctgtgcttcctgcag
gacccctggaagctctatcgctgccacaccatcctcaactgcaccaacacctgtccgaag
aacctgaatccggccagagccatcatccagttgaagcagttgctgtcgggggccaaaaag
aagaacaagccggagctacagaccgatgctctattcaccggcaagtaa

DBGET integrated database retrieval system