KEGG   Drosophila persimilis: Dper_GL11174Help
Entry
Dper_GL11174      CDS       T01063                                 

Definition
(RefSeq) GL11174 gene product from transcript GL11174-RA
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dpe  Drosophila persimilis
Pathway
dpe03030  DNA replication
dpe03410  Base excision repair
dpe03420  Nucleotide excision repair
dpe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dpe00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dper_GL11174
   03410 Base excision repair
    Dper_GL11174
   03420 Nucleotide excision repair
    Dper_GL11174
   03430 Mismatch repair
    Dper_GL11174
Enzymes [BR:dpe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dper_GL11174
    6.5.1.6  DNA ligase (ATP or NAD+)
     Dper_GL11174
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Dper_GL11174
DNA replication proteins [BR:dpe03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Dper_GL11174
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Dper_GL11174
DNA repair and recombination proteins [BR:dpe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Dper_GL11174
   NER (nucleotide excision repair)
    Other NER factors
     Dper_GL11174
   MMR (mismatch exicision repair)
    Other MMR factors
     Dper_GL11174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme Orthopox_A49R
Motif
Other DBs
NCBI-GeneID: 6591299
NCBI-ProteinID: XP_002015628
FlyBase: FBgn0148784
UniProt: B4GCY0
LinkDB All DBs
AA seq 744 aa AA seqDB search
MQQSITSYFKQKSDVPESPGKARPVSKIKSEVDLAENEPKIKREDETSEANIEANRIIDP
NPSIIEAMEIKEEPTSKVERKVTTIGLNSTSKDNKEEVENYDPSNEAYHPLEHAYWKAKA
VTPYLALARTFQVIEETKGRLKMIDTLSNFFSSVMLVSPNDLLPSVYLSINQLAPAYEGL
ELGVAETTLMKAICKATGRNLAHIKSQTHLTGDLGIVAEQSRVSQRMMFQPAPLNIRGVF
NKLREIAKISGQSKMTLVYDVFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIALVK
KNHINDCKVSKIVDVYKDEITETTLLLKTAYSQCPNYDIIIPAILKYDIKELQERCPMHP
GMPLRPMLAQPTKGVHEVFERFGSMHITCEWKYDGERAQIHCNERGEISIFSRNSENNTA
KYPDLIARSKGFLKGAVQSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVC
VYIFDLLYINGTTLVTSPLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESVK
GNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYG
GFLLACYDTENEEYQSICKIGTGFTDEDLRIHSEFLGKHVIPSAKSYFRYDSSLEPDHWF
EPAQVWEVKCADLSLSPIHRAAIGIVDTERGISLRFPRFIRIRDDKSSENATDANQVAHM
YQSQDQVKNNQRTCTQMDMESEFY
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagtccataacttcctattttaagcaaaaatccgatgtgccggagagccctggc
aaagccagaccagtttcgaaaattaagtcggaggttgatttggctgaaaatgaaccaaaa
atcaagcgtgaagatgagacctctgaagctaatattgaagcaaaccgtattattgatcca
aatccgagcataattgaagctatggaaatcaaggaggagccgacaagcaaagttgaacgg
aaagtaacaacaattggactgaactccacatctaaagataacaaagaggaagtggaaaac
tacgatccttcaaacgaagcctatcatcccctggagcacgcatactggaaggccaaagcg
gtgacaccgtatttggcgttagctcgaacgtttcaagtgatagaggagaccaaaggccgc
ctcaagatgattgatacgttaagcaattttttttcctcggttatgttagttagcccaaat
gacttgctgcccagtgtttatctcagtattaaccagctggcccccgcctacgaggggctg
gaacttggtgtggctgagacaacgttaatgaaggcaatctgcaaggcgacgggccgtaac
ttggcacacatcaaatctcaaacgcacttaaccggcgacctgggcattgtcgccgagcag
tcgcgcgtttcgcaacgcatgatgtttcagcctgctccactgaacatcagaggagtattc
aacaagctaagagaaatagccaagatatctggtcagtccaagatgactctcgtctatgat
gtctttgtggcctgtcgatcatctgaggctcgtttctttatacgctccctgatcggcaag
ttgcgcattggcatcgcagagcaaagtcttctcactgctcttgcaattgctttggtgaag
aaaaatcacattaacgactgcaaggtcagcaaaatagtcgacgtttacaaagatgaaata
acggagactacgttattgctgaaaacagcatatagccaatgccccaactacgacattatt
attcctgcaatattgaagtatgacatcaaggagctccaagaacgttgccccatgcaccca
ggcatgccgctgaggccaatgctcgcacaaccaacaaaaggagttcatgaggtgtttgag
cgctttggaagcatgcacataacgtgcgaatggaaatacgacggcgaacgagcccagatt
cactgcaacgagcggggagagataagcatattctctcgcaactcggagaacaacacggcg
aagtatccggatttgattgccaggagcaaaggtttccttaagggtgcagtgcagtcttac
attattgatagcgaaatcgttgcctgggacgttgagcgaaagcagattctgccattccaa
gtactcagtacgcgcaaaagaaaaaacgtggacatagaagagatcaaagttcaagtctgt
gtttacatattcgatcttctgtatattaatggtacgacccttgtcacaagtccattatcc
gagcgccgcaagctgctgctagaacatttccaggaagtcgaaggtgaatggaaattcgcc
acagctctggacactaacgatattgatgaggtgcagcaatttttagaggaatcagttaaa
ggcaattgtgagggactcatggtcaagacattggatgaggaagccacgtatgaaatcgca
aaaagatcaaggaattggcttaagttgaaaaaggattatttgtcaaatgtgggcgactcg
cttgatcttgttgtaattggcggctacaaaggaaagggacgacgaaccgggacctatggc
ggatttctgcttgcctgctatgacaccgaaaacgaggaataccagagcatctgcaaaatt
gggacagggttcactgatgaagatttgcggatacactctgaattcttaggcaaacatgtc
atacccagtgccaagtcatactttagatatgactcaagcctggaaccggaccactggttt
gagccggctcaggtttgggaagtaaagtgcgcagacctctcccttagccccatccataga
gcagccataggcatcgttgacaccgagcggggtatttcgctgcgattcccccgattcatt
cgaattcgagatgataagagcagcgaaaacgcaacagatgccaatcaagtagcccacatg
taccagtcgcaggatcaggttaagaataatcagaggacttgtacgcagatggatatggag
agcgagttctactga

DBGET integrated database retrieval system