KEGG   Drosophila persimilis: Dper_GL11223Help
Entry
Dper_GL11223      CDS       T01063                                 

Definition
(RefSeq) GL11223 gene product from transcript GL11223-RA
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dpe  Drosophila persimilis
Pathway
dpe00052  Galactose metabolism
dpe00500  Starch and sucrose metabolism
dpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dper_GL11223
   00500 Starch and sucrose metabolism
    Dper_GL11223
Enzymes [BR:dpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dper_GL11223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase 4HB_MCP_1
Motif
Other DBs
NCBI-GeneID: 6590438
NCBI-ProteinID: XP_002015734
FlyBase: FBgn0148832
UniProt: B4GDE8
LinkDB All DBs
AA seq 564 aa AA seqDB search
MPKWVHLCLVAVLVAIAGCADIDWWENASLYQIYPRSFQDSDGDGIGDLKGITSRLSYLK
EIGITATWLSPVFTSPMSDFGYDISNFFDIDPIFGTLDDFDALIVEAKSLGVKIILDFVP
NHSSDENEWFDKSVNRVDGYDDFYVWHDGKVNAETGEREPPSNWISVFGGPQWTWHETRQ
QYFLHQFQVKQPDLNFTNPMVREHMLDVLKFWLDRGVDGFRIDAVPHIYEYRNADGSYSD
EPVSGWSSNPEAYDYHDHIYTKDQPATVELMYEWRAFLDQYRTENGGDSRVLLAEAFSSV
ETLSAYFGNGTHLGTQLPMNFQLMYLSGYSTARDVVSSIDYWMNTMWTEHQTANWVVGNH
DTNRVADRMGAHKVDLLNVIVSALPGASITYYGEEIGMSNVDVECTGDSCEDRDGERTPM
QWTAGRNADFSQGENTWLPLNPDYERFNVQTERGVARSSLNIFKGMQALKSSSAFQSFKQ
EGGFSYEAITNQVLQIIRTNKYSEEYRILVNMGNGMEIIDGLADKVFEYVLTTAYSSHHQ
GQTVDLRERILLMPYEAVVLRWLA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagtgggtacatctctgtctggtcgcagtgttggtggccattgccgggtgcgcg
gacatcgattggtgggagaacgcatccctgtaccagatctatccgcgatccttccaggac
agcgatggcgacggcatcggcgacctgaagggcatcacatcgcggttgagctacctaaag
gagatcggcataacggccacatggctgtcgcccgttttcacatcacccatgtcggatttt
gggtacgatatctcgaacttcttcgacattgatcccatctttggaacactcgatgacttc
gatgcgctaattgtggaagccaagtcgctgggggtgaaaatcatactggactttgtgccc
aatcattccagcgatgagaatgaatggttcgacaagtcggtgaaccgtgttgatggctac
gatgacttctacgtgtggcacgacggcaaggtgaatgcggaaactggtgaacgggagccg
cccagcaattggatcagcgtttttggcggtcctcagtggacctggcacgagacacgacag
cagtacttcctgcaccaattccaggtgaagcagccggacctcaatttcaccaatcctatg
gtgcgggagcacatgctggatgtccttaagttctggctggatcggggcgtcgatggattc
cgcattgatgcagttccacacatctatgagtaccgtaatgcggatggctcctattctgac
gagcctgtcagtggctggagcagtaatccggaggcgtacgactaccatgaccatatctac
accaaggatcagcccgctactgttgagttgatgtacgagtggcgtgccttccttgaccag
taccgaacggagaatggaggtgattcccgagttctgctggccgaagccttctcctctgta
gaaacgctcagtgcgtatttcggaaatggcacccacttgggcacccagctccccatgaac
ttccaactgatgtacctcagcggctactccacagcgcgggatgtggtgagctccatcgac
tactggatgaataccatgtggacggaacatcagacagccaattgggtggtgggcaaccac
gacaccaatcgggtggccgaccgcatgggtgcccacaaagttgatctgctgaacgtgatc
gtgagtgctcttcccggtgcatcgatcacctactacggcgaggagatcggcatgtccaat
gtggatgtggagtgcaccggagactcgtgcgaagatcgagatggggagcgcacacccatg
cagtggacagcgggccgaaatgccgacttctcccagggcgagaacacctggctgcccctc
aatccggactatgagcgcttcaatgtgcagaccgaacggggagtggctcgatcttctctg
aacatcttcaagggtatgcaggcgctgaagagcagctccgcattccaatctttcaagcag
gaaggcggtttctcctatgaggcaatcacaaatcaagtcttgcagatcatacgaacaaac
aagtacagtgaggaatatcgcatcctggtcaacatgggcaacggcatggaaataatcgat
ggcctggctgataaggtctttgagtatgtcctcaccactgcctactcctcgcaccatcaa
gggcaaaccgttgatctcagagaacgcattttgcttatgccttacgaagctgtcgtacta
cgctggctcgcctga

DBGET integrated database retrieval system