KEGG   Drosophila persimilis: Dper_GL11674Help
Entry
Dper_GL11674      CDS       T01063                                 

Definition
(RefSeq) GL11674 gene product from transcript GL11674-RA
Organism
dpe  Drosophila persimilis
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 6590649
NCBI-ProteinID: XP_002016610
FlyBase: FBgn0149283
UniProt: B4GCT7
LinkDB All DBs
AA seq 70 aa AA seqDB search
MDVMSSSLQQQRIVVDQLRREASMERQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNP
FREKSSCTVL
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggacgtaatgtcatcatctctacaacaacagcgcattgtcgttgaccagctgcgtcgc
gaggcgtcgatggaacggcagaccatttcggagtcgtgcgccaaaatgatgaagtacatc
acggagcacgagcaggaggattaccttttgactggattcaccagccagaaggtaaatcca
ttccgtgaaaagtcttcatgcaccgttctttaa

DBGET integrated database retrieval system